Detailed information of component protein


Summary

Component ID T6CP015507
Component protein type TagH
T6SS ID (Type) T6SS01235 experimental (Type i1)
Strain Vibrio vulnificus 106-2A
Replicon chromosome
Sequence Protein sequence (490 a.a.); Nucleotide sequence (1470 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VV1062A_RS01735
Coordinate (Strand) 163632..165101 (+)
NCBI ID 1119685172
RefSeq NZ_LMTD01000002
Uniprot ID UPI00092591EB
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
FHA PF00498.28 2.8e-05 35..102

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-489 MNSVVLPSLTLLVINAQHLESGLSAQYTWTPAGGIIGSSTKAQWRLVDTLGSVKPEHCEILMVDGAFCIKDHCGSTYINGAYMPLGVKKLARLAHKDEITVGPYRLRVLLGNELDIEEQHGSLEILFSSQQEDLLANFELEYSPEMDEIPLNTDPLQALDSRVKKPDAETTLLSELNNTIAPSEQTTILPQDNLVLSNANVTPQADSEYEISSSIRLKKILGFAKATFLKQTKQEARSVSSETSIISKTSESDRAEGLKMDEKVLDLLEEEVAKSFQSKMENSTNNISNNQTNHLVTGPILEGLGVDLNNGNDLARMHMLSFELGESLQACVRGLLDLYLQVNESRFGTLNRNLQPIEDNPLRLGLSYEDTIRTLYDNDKSVVHLSAPAAIEESLKNLRDHNEAMQFATSEALQQILNAFSPQIMLRRFKNYKRSSDTTQSSNDAWAWNMYCSYYQELTSNRQRGFEKLFWEIFEQAYDRKIREKQLEL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.5488 pos: 16-17. INA-QH. MNSVVLPSLTLLVINA



  Protein sequence: 490 a.a.    

>T6CP015507 NZ_LMTD01000002:163632-165101 [Vibrio vulnificus] [TagH]
MNSVVLPSLTLLVINAQHLESGLSAQYTWTPAGGIIGSSTKAQWRLVDTLGSVKPEHCEILMVDGAFCIKDHCGSTYING
AYMPLGVKKLARLAHKDEITVGPYRLRVLLGNELDIEEQHGSLEILFSSQQEDLLANFELEYSPEMDEIPLNTDPLQALD
SRVKKPDAETTLLSELNNTIAPSEQTTILPQDNLVLSNANVTPQADSEYEISSSIRLKKILGFAKATFLKQTKQEARSVS
SETSIISKTSESDRAEGLKMDEKVLDLLEEEVAKSFQSKMENSTNNISNNQTNHLVTGPILEGLGVDLNNGNDLARMHML
SFELGESLQACVRGLLDLYLQVNESRFGTLNRNLQPIEDNPLRLGLSYEDTIRTLYDNDKSVVHLSAPAAIEESLKNLRD
HNEAMQFATSEALQQILNAFSPQIMLRRFKNYKRSSDTTQSSNDAWAWNMYCSYYQELTSNRQRGFEKLFWEIFEQAYDR
KIREKQLEL*

  Nucleotide sequence: 1470 bp    

>T6CP015507 NZ_LMTD01000002:163632-165101 [Vibrio vulnificus] [TagH]
ATGAATTCAGTGGTGCTACCTTCGTTGACCCTATTGGTTATCAATGCTCAGCATTTAGAGTCGGGCTTGTCAGCACAATA
CACATGGACACCAGCAGGAGGAATAATTGGCTCATCTACAAAAGCTCAATGGCGTTTAGTTGATACTCTGGGTAGTGTAA
AACCCGAGCACTGTGAAATTTTAATGGTCGATGGTGCATTCTGTATCAAAGACCATTGTGGCAGTACTTATATCAATGGC
GCATATATGCCGCTGGGGGTTAAGAAGCTGGCGCGCCTAGCTCACAAAGATGAAATCACTGTTGGGCCTTATCGTTTAAG
AGTTTTGTTAGGAAATGAGCTTGATATAGAAGAGCAGCATGGCTCATTAGAAATATTGTTCTCTTCGCAGCAAGAGGATC
TACTAGCAAACTTTGAGTTGGAATACAGCCCTGAAATGGATGAGATCCCGTTAAACACAGATCCGTTACAAGCTTTGGAT
TCTCGAGTAAAAAAGCCAGATGCCGAGACAACACTGTTGAGTGAATTAAACAACACTATCGCACCATCAGAGCAAACCAC
CATACTGCCTCAAGACAACTTGGTACTAAGTAACGCCAATGTTACGCCACAGGCTGATAGCGAGTATGAGATCTCTTCAT
CAATCAGACTCAAGAAAATTCTTGGCTTTGCTAAAGCCACTTTTTTAAAGCAAACCAAACAAGAAGCACGGAGTGTGTCT
TCTGAAACAAGCATCATTTCTAAAACCAGTGAAAGTGACCGAGCAGAGGGCCTAAAAATGGATGAAAAAGTACTGGACTT
GTTGGAAGAAGAGGTAGCTAAGAGTTTCCAATCAAAAATGGAAAATAGCACAAACAACATATCGAACAATCAAACGAATC
ATTTAGTTACTGGGCCAATTTTGGAAGGGCTAGGTGTTGACTTGAATAATGGAAATGATTTGGCACGAATGCATATGCTG
TCTTTTGAACTAGGTGAGTCATTGCAAGCATGTGTTCGAGGGTTGCTCGATTTGTATCTGCAGGTGAATGAAAGCCGTTT
CGGTACATTGAACAGAAACTTACAGCCAATTGAAGACAATCCGCTGCGTTTGGGACTCTCGTATGAGGATACAATTCGTA
CCCTTTATGATAACGACAAAAGTGTTGTTCACTTATCTGCGCCAGCAGCCATTGAAGAAAGTTTAAAAAACTTGCGTGAT
CATAACGAAGCTATGCAGTTTGCGACCTCAGAAGCATTGCAGCAAATTCTCAACGCATTTTCTCCACAAATCATGTTACG
TCGTTTTAAGAATTATAAGCGTAGCTCCGATACGACTCAGAGCTCTAATGATGCTTGGGCTTGGAACATGTATTGCAGTT
ACTACCAAGAATTGACTTCCAATCGACAGCGCGGTTTTGAAAAATTGTTTTGGGAGATCTTTGAGCAAGCCTATGACCGA
AAAATTCGTGAGAAGCAACTGGAGCTATGA