Detailed information of component protein


Summary

Component ID T6CP015474
Component protein type TssB
T6SS ID (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (177 a.a.); Nucleotide sequence (531 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) V12G01_RS31205
Coordinate (Strand) 1453907..1454437 (+)
NCBI ID WP_005375949.1
RefSeq NZ_CH902589
Uniprot ID A0A0H0YGF1_VIBAL
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 6.2e-62 9..161

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-176 MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDVLKKMNPSVKFKVANKLANDDSQFEVDLNFKSMQDFEPAAIVNQVDPLRQLMETRNKLRDLMTKVDRSEELENILEDVLNNTDNLARLAGELDLGKKAKSDSTEGAE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9966 - -



  Protein sequence: 177 a.a.    

>T6CP015474 NZ_CH902589:1453907-1454437 [Vibrio alginolyticus 12G01] [TssB]
MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDVLKKMNPSVKF
KVANKLANDDSQFEVDLNFKSMQDFEPAAIVNQVDPLRQLMETRNKLRDLMTKVDRSEELENILEDVLNNTDNLARLAGE
LDLGKKAKSDSTEGAE*

  Nucleotide sequence: 531 bp    

>T6CP015474 NZ_CH902589:1453907-1454437 [Vibrio alginolyticus 12G01] [TssB]
ATGACGAGTATCCACTCGAAACTATCACGAGTACGGAAGCCTCGTGTCCACATTACCTATGATGTTGAAACTGAAGGTAC
GACTCTTAAGAAAGAACTGCCTTTTGTTGTAGGTGTAATGGGTGACTTCGCTGGTCAAAACACAGAAGCGTTGAAGCCAT
TAAAAGACCGCCGTTTTATTCAGATCGATCGAGATAACTTTGACGATGTACTCAAAAAAATGAATCCATCGGTGAAGTTT
AAAGTTGCGAATAAGCTTGCGAATGACGATTCACAGTTTGAGGTCGATTTAAACTTTAAATCAATGCAAGACTTTGAGCC
TGCTGCGATCGTAAATCAAGTTGATCCACTACGCCAATTGATGGAAACGCGTAATAAACTGCGTGATTTGATGACAAAAG
TTGACCGCTCAGAAGAGCTTGAAAATATCCTAGAGGATGTTTTGAACAATACAGACAATCTGGCAAGACTTGCAGGCGAG
TTAGATCTTGGCAAGAAAGCGAAGTCAGACAGTACTGAAGGAGCGGAATAA