Detailed information of component protein


Summary

Component ID T6CP015423
Component protein type TssG
T6SS ID (Type) T6SS01219 experimental (Type i4a)
Strain Pseudomonas syringae pv. actinidiae str. Shaanxi_M228
Replicon chromosome
Sequence Protein sequence (340 a.a.); Nucleotide sequence (1020 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) CN228_RS17605
Coordinate (Strand) 3628865..3629884 (+)
NCBI ID WP_020312721.1
RefSeq NZ_CP032631
Uniprot ID A0A8B3GHC4_PSESF
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssG PF06996.13 4.5e-75 20..316

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-339 METAGRQAAVSLSATLRQTPQAFELLQALLVLEREQPQAASLGTGTSPHAEAVRLRGPLTPVFASSQIESLVQEHDQQAVLTTPVFGLGGPDGPLPYAFQEWLQQRARAKDHAPAEFLDLFQHRLLSLLYRILRKHRIAAGYSVPSASPVQAQLRALTGLLPQPLQERQALPDAALLARSALFADGRRSLAGFAAIIRQHFLVPVQVSAYQGAWRDIPAASRSRLKPGGRNLTLGSSAIAGTRVWDEHAGVRLTLGPLSSEQADSLLPDGTAHQHLAGFAALYFGPDLDCALTLLVAGAKPMVMDREQRPALNWNLGLHRQPTSQQQRIDTYLRQAEIV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9122 - -



  Protein sequence: 340 a.a.    

>T6CP015423 NZ_CP032631:3628865-3629884 [Pseudomonas syringae pv. actinidiae str. Shaanxi_M228] [TssG]
METAGRQAAVSLSATLRQTPQAFELLQALLVLEREQPQAASLGTGTSPHAEAVRLRGPLTPVFASSQIESLVQEHDQQAV
LTTPVFGLGGPDGPLPYAFQEWLQQRARAKDHAPAEFLDLFQHRLLSLLYRILRKHRIAAGYSVPSASPVQAQLRALTGL
LPQPLQERQALPDAALLARSALFADGRRSLAGFAAIIRQHFLVPVQVSAYQGAWRDIPAASRSRLKPGGRNLTLGSSAIA
GTRVWDEHAGVRLTLGPLSSEQADSLLPDGTAHQHLAGFAALYFGPDLDCALTLLVAGAKPMVMDREQRPALNWNLGLHR
QPTSQQQRIDTYLRQAEIV*

  Nucleotide sequence: 1020 bp    

>T6CP015423 NZ_CP032631:3628865-3629884 [Pseudomonas syringae pv. actinidiae str. Shaanxi_M228] [TssG]
ATGGAAACCGCAGGCCGGCAGGCCGCTGTCTCTTTAAGCGCGACCCTGCGCCAGACGCCGCAGGCCTTTGAGCTGTTGCA
GGCGCTGCTGGTGCTGGAGCGCGAACAACCTCAGGCCGCGTCGCTGGGCACAGGCACATCGCCGCATGCCGAAGCGGTGC
GGTTGCGCGGCCCGCTGACACCGGTTTTCGCCTCCAGCCAGATTGAAAGCCTGGTTCAGGAGCACGACCAACAGGCGGTG
CTGACCACGCCGGTGTTCGGCCTCGGCGGCCCCGACGGTCCTTTGCCCTACGCCTTTCAGGAATGGCTGCAGCAACGAGC
CCGCGCCAAGGACCACGCACCGGCCGAGTTCCTTGACCTTTTTCAGCATCGGCTGCTCAGCCTGCTCTACCGGATACTGC
GCAAACACCGCATTGCTGCGGGCTACTCAGTACCATCGGCCAGCCCGGTTCAGGCGCAATTGCGCGCACTGACCGGCCTG
CTGCCACAACCACTGCAAGAGCGCCAGGCACTGCCTGATGCCGCCCTTCTGGCCCGCAGCGCATTGTTTGCCGATGGCCG
CCGCTCGCTGGCAGGCTTTGCCGCCATCATCCGCCAACACTTCCTGGTGCCCGTGCAGGTCAGCGCTTATCAGGGCGCAT
GGCGCGACATTCCGGCCGCCAGCCGCAGTCGCCTCAAGCCTGGCGGGCGCAACCTGACACTGGGCAGCAGCGCCATCGCT
GGCACCCGAGTCTGGGATGAACACGCGGGCGTGCGTCTGACCCTTGGCCCACTGAGCAGCGAACAGGCCGACAGCCTGCT
GCCTGACGGCACGGCGCATCAGCACCTGGCCGGGTTTGCCGCGCTGTATTTCGGCCCCGACCTCGACTGCGCGCTGACCT
TGCTGGTGGCAGGCGCAAAACCGATGGTGATGGACCGCGAGCAGCGCCCTGCCCTGAACTGGAACCTTGGCCTGCATCGT
CAGCCCACGTCACAACAGCAGCGCATCGACACTTACCTGCGCCAGGCGGAGATTGTCTGA