Detailed information of component protein


Summary

Component ID T6CP015420
Component protein type TssD
T6SS ID (Type) T6SS01219 experimental (Type i4a)
Strain Pseudomonas syringae pv. actinidiae str. Shaanxi_M228
Replicon chromosome
Sequence Protein sequence (166 a.a.); Nucleotide sequence (498 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) CN228_RS17590
Coordinate (Strand) 3626159..3626656 (+)
NCBI ID WP_003382818.1
RefSeq NZ_CP032631
Uniprot ID A0A0K8LVH9_PSESF, A0A0Q0E7D9_PSESX, A0A0P9M4H6_9PSED, A0A261WDE1_9PSED, A0A3M3S092_9PSED
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 4.6e-30 10..138

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-165 MDAIILDLGDEIKGDSLLEGYKDKIEIMSYSHNVAMQVTNDVSNSERTSGKPHIGEFTLTKFVDSSTPTLNSYCCAGKPIPKATIVIGRNAAEGSGQLMAFITYTLDNVVLSNVSVSGGTGGKPVETLSLNFTKIKWELTAQKDDGTKEGVAGTSWDMAANKKAS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9916 - -



  Protein sequence: 166 a.a.    

>T6CP015420 NZ_CP032631:3626159-3626656 [Pseudomonas syringae pv. actinidiae str. Shaanxi_M228] [TssD]
MDAIILDLGDEIKGDSLLEGYKDKIEIMSYSHNVAMQVTNDVSNSERTSGKPHIGEFTLTKFVDSSTPTLNSYCCAGKPI
PKATIVIGRNAAEGSGQLMAFITYTLDNVVLSNVSVSGGTGGKPVETLSLNFTKIKWELTAQKDDGTKEGVAGTSWDMAA
NKKAS*

  Nucleotide sequence: 498 bp    

>T6CP015420 NZ_CP032631:3626159-3626656 [Pseudomonas syringae pv. actinidiae str. Shaanxi_M228] [TssD]
ATGGATGCGATCATTCTCGATCTGGGCGACGAGATCAAAGGCGACAGTTTGCTGGAAGGTTACAAGGACAAGATCGAAAT
CATGTCCTACAGCCACAACGTGGCCATGCAGGTTACAAACGATGTCAGCAACTCCGAGCGGACTTCGGGCAAGCCACACA
TCGGCGAGTTCACCCTGACCAAGTTCGTCGACAGCTCCACCCCGACCCTCAACAGCTATTGCTGCGCCGGCAAGCCGATT
CCGAAAGCGACCATTGTCATCGGGCGTAACGCGGCAGAGGGCAGCGGCCAACTGATGGCGTTCATCACCTACACGCTGGA
TAACGTGGTGCTGTCAAACGTCAGTGTCAGTGGCGGTACCGGTGGCAAACCGGTCGAAACCCTGTCGCTGAACTTCACCA
AGATCAAATGGGAGCTGACCGCCCAGAAAGACGACGGCACCAAGGAAGGCGTGGCCGGCACCAGCTGGGACATGGCCGCC
AACAAGAAAGCCAGTTAA