Detailed information of component protein
Summary
| Component ID | T6CP015376 |
| Component protein type | TssG |
| T6SS ID (Type) | T6SS01215  (Type i2) |
| Strain | Klebsiella pneumoniae strain Kp52.145 |
| Replicon | chromosome |
| Sequence | Protein sequence (362 a.a.); Nucleotide sequence (1086 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 2587801..2588886 (+) |
| NCBI ID | WP_004190503.1 |
| RefSeq | NZ_FO834906 |
| Uniprot ID | A0A7U9CYK9_KLEPN, A0A652Q199_9ENTR, W9B806_KLEPN, A0A3F3B3D4_KLEPN |
| KEGG ID | kpnk:BN49_2478, kpy:KPNIH31_11115 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-361 | MGREAQPPHSRLTPRLEADLPRINFYRFCQLLEKRRPGQPLMGGTSHPADDPVRFYPHPGMGFPASELKAVEYDEADDSRPPVIRTTFMGLYGVDSPLPTAYLDDIAQHREGHEALQGLLDIFSHRIMTQFYRIWRKYSWPATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLALTGVLRQPGKTQQGIQALVTLLAPETTVRVSPYSLRPVAISQPLGFYGDDDFFLDGNTPLGDEAMDASSQLLVALTTDNPAEAQGWKPDGPLFRDFLILLRVYLGWRFRANITLTAPTRLLAVPPLGDEPFWLGMNGVLGVGEGESEGDIPQTFTTELGTYTGLQPATFLQGNRRVTYKFD |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.9812 | - | - |
Protein sequence: 362 a.a.
Nucleotide sequence: 1086 bp