Detailed information of component protein


Summary

Component ID T6CP015367
Component protein type TssC
T6SS ID (Type) T6SS01214 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (83 a.a.); Nucleotide sequence (249 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BN49_RS06045
Coordinate (Strand) 972197..972445 (-)
NCBI ID WP_004142899.1
RefSeq NZ_FO834906
Uniprot ID A0A483R446_KLEPN
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-82 MSAKEHISSSAAMSTMMGSGGIYQSLFKKIHLTVAIHTPLSCLAKSAEDVVMHQPDVQHVKSRWHGLRFLKCQKQKPDRAVV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8740 - -



  Protein sequence: 83 a.a.    

>T6CP015367 NZ_FO834906:c972445-972197 [Klebsiella pneumoniae] [TssC]
MSAKEHISSSAAMSTMMGSGGIYQSLFKKIHLTVAIHTPLSCLAKSAEDVVMHQPDVQHVKSRWHGLRFLKCQKQKPDRA
VV*

  Nucleotide sequence: 249 bp    

>T6CP015367 NZ_FO834906:c972445-972197 [Klebsiella pneumoniae] [TssC]
ATGTCTGCAAAGGAACATATTTCTTCATCTGCGGCTATGTCAACAATGATGGGATCAGGCGGCATTTATCAGTCGTTGTT
TAAAAAAATACATCTGACGGTAGCTATCCATACTCCACTTTCCTGTCTGGCGAAATCTGCGGAGGATGTGGTTATGCATC
AGCCAGACGTCCAGCACGTTAAGTCACGCTGGCACGGTCTCAGGTTTCTCAAATGCCAAAAGCAAAAACCTGACCGGGCG
GTGGTGTAG