Detailed information of component protein


Summary

Component ID T6CP015366
Component protein type TssK
T6SS ID (Type) T6SS01214 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (447 a.a.); Nucleotide sequence (1341 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BN49_RS06040
Coordinate (Strand) 970855..972195 (-)
NCBI ID WP_004142901.1
RefSeq NZ_FO834906
Uniprot ID A6TD95_KLEP7, W9B484_KLEPN, R4YD55_KLEPR
KEGG ID kpx:PMK1_00651, kpn:KPN_03168, kpr:KPR_4179, kpnk:BN49_0947
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 2.5e-134 18..443

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-446 MKIHRPLWAEGTFLSSQQFQQQARWETYSNNSIAQLGIRHPWGVARVEFDREALALGKLKLRTLRLRFSDGSLIDSEVSDALPLACDLHTLAVENTAIVVLALPLEHANGGNLGQEKHTERPLRYRQEWHKVQDIYGSDSEEMAVECHALSLRFAHDNNQDYITCPLARLTRNGQGNWSQDESYIPPLLALSAHIGLVERLDTLLLQLQAKCRRLMALRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPSIHPELVWRELARLAGALLTFSLEHNVSAIPAYVHDAPASVFPPLFTLLSELLEASLPSRVIALELESLPGNRWKAELHDPRLREEADFYLSVRSSLPTHVVLQQLPRLCKIGAPDDVTLLVNVALNGVPVVPLTQVPAALPLRLENQYFALDMQSAPAKAMLDAGCCMIYAPGTLGDLKPELFAVLRS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9565 - -



  Protein sequence: 447 a.a.    

>T6CP015366 NZ_FO834906:c972195-970855 [Klebsiella pneumoniae] [TssK]
MKIHRPLWAEGTFLSSQQFQQQARWETYSNNSIAQLGIRHPWGVARVEFDREALALGKLKLRTLRLRFSDGSLIDSEVSD
ALPLACDLHTLAVENTAIVVLALPLEHANGGNLGQEKHTERPLRYRQEWHKVQDIYGSDSEEMAVECHALSLRFAHDNNQ
DYITCPLARLTRNGQGNWSQDESYIPPLLALSAHIGLVERLDTLLLQLQAKCRRLMALRRESNQRMADFAVADVSLFWLL
NALNSAEPVLSDFLRYPSIHPELVWRELARLAGALLTFSLEHNVSAIPAYVHDAPASVFPPLFTLLSELLEASLPSRVIA
LELESLPGNRWKAELHDPRLREEADFYLSVRSSLPTHVVLQQLPRLCKIGAPDDVTLLVNVALNGVPVVPLTQVPAALPL
RLENQYFALDMQSAPAKAMLDAGCCMIYAPGTLGDLKPELFAVLRS*

  Nucleotide sequence: 1341 bp    

>T6CP015366 NZ_FO834906:c972195-970855 [Klebsiella pneumoniae] [TssK]
ATGAAAATTCATCGACCACTATGGGCTGAGGGAACGTTCCTGTCCTCACAACAGTTTCAGCAGCAGGCCCGCTGGGAAAC
GTACAGTAACAACAGCATTGCACAGCTGGGTATCCGTCATCCATGGGGTGTGGCGAGAGTCGAGTTTGACAGAGAAGCGC
TGGCGTTAGGGAAGTTAAAATTACGTACCCTGCGCCTGCGTTTTTCCGATGGCTCGTTGATCGACTCCGAAGTTTCCGAT
GCGCTGCCTCTGGCTTGTGATTTACATACTCTGGCGGTGGAAAATACGGCAATAGTTGTCCTGGCGTTACCGCTGGAACA
TGCGAATGGCGGTAATCTGGGACAGGAAAAGCATACTGAAAGACCCCTGCGTTATCGTCAGGAATGGCATAAAGTACAGG
ATATTTATGGCAGCGACAGTGAAGAAATGGCCGTTGAATGCCATGCGCTGTCATTGCGTTTCGCCCATGATAACAATCAG
GATTACATCACCTGCCCGCTTGCACGTCTGACGCGGAATGGTCAGGGTAACTGGTCTCAGGATGAAAGCTACATCCCGCC
GCTGCTTGCCCTCAGCGCACATATTGGTCTGGTGGAGCGACTGGATACGTTGCTGTTGCAGCTACAAGCGAAGTGCCGGC
GTCTGATGGCCCTGCGCCGGGAAAGCAATCAGCGTATGGCGGACTTCGCGGTAGCGGATGTGTCCCTGTTCTGGTTACTC
AATGCGTTGAACAGCGCTGAACCGGTTCTAAGTGATTTTTTACGGTATCCGAGCATCCATCCTGAACTCGTCTGGCGCGA
ACTGGCTCGTCTGGCCGGCGCGTTGCTGACCTTTTCCCTTGAACACAACGTGAGCGCCATTCCCGCATATGTCCATGATG
CTCCAGCCTCCGTTTTTCCGCCGCTTTTTACCCTGCTCAGCGAACTGCTCGAAGCCAGCCTGCCGTCGCGGGTGATTGCG
CTCGAGCTGGAATCCCTTCCCGGCAACCGCTGGAAAGCCGAACTTCACGATCCACGCCTGCGGGAAGAGGCGGATTTTTA
CCTTTCTGTTCGCTCCTCGCTGCCGACGCACGTCGTTCTGCAACAGTTACCACGGCTCTGCAAAATCGGGGCGCCGGATG
ACGTTACGTTGTTGGTTAATGTTGCGCTGAACGGTGTCCCTGTTGTTCCGCTGACGCAGGTTCCGGCTGCATTGCCATTA
CGGCTGGAGAATCAGTACTTTGCGCTGGATATGCAGAGCGCTCCGGCTAAAGCCATGCTGGATGCCGGGTGCTGCATGAT
TTACGCGCCGGGTACGCTGGGCGATCTGAAACCCGAGCTTTTTGCGGTTCTGCGGTCATGA