Detailed information of component protein


Summary

Component ID T6CP015336
Component protein type TssL
T6SS ID (Type) T6SS01212 experimental (Type i4a)
Strain Pseudomonas aeruginosa PAK
Replicon chromosome
Sequence Protein sequence (51 a.a.); Nucleotide sequence (153 bp)
Reference
[1] Chen R, Weng Y, Zhu F, et al. Polynucleotide Phosphorylase Regulates Multiple Virulence Factors and the Stabilities of Small RNAs RsmY/Z in Pseudomonas aeruginosa. Front Microbiol. 2016 Mar 2;7:247. doi: 10.3389/fmicb.2016.00247. eCollection 2016. PMID: 26973625
[2] Li K, Xu C, Jin Y, et al. SuhB is a regulator of multiple virulence genes and essential for pathogenesis of Pseudomonas aeruginosa. mBio. 2013 Oct 29;4(6):e00419-13. doi: 10.1128/mBio.00419-13. PMID: 24169572
[3] Brencic A, Lory S. Determination of the regulon and identification of novel mRNA targets of Pseudomonas aeruginosa RsmA. Mol Microbiol. 2009 May;72(3):612-32. doi: 10.1111/j.1365-2958.2009.06670.x. PMID: 19426209
[4] Marden JN, Diaz MR, Walton WG, et al. An unusual CsrA family member operates in series with RsmA to amplify posttranscriptional responses in Pseudomonas aeruginosa. Proc Natl Acad Sci U S A. 2013 Sep 10;110(37):15055-60. doi: 10.1073/pnas.1307217110. Epub 2013 Aug 26. PMID: 23980177
[5] Aragon IM, Pérez-Mendoza D, Moscoso JA, et al. Diguanylate cyclase DgcP is involved in plant and human Pseudomonas spp. infections. Environ Microbiol. 2015 Nov;17(11):4332-51. doi: 10.1111/1462-2920.12856. Epub 2015 Apr 28. PMID: 25809128
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene) Y880_RS09155
Coordinate (Strand) 1918673..1918825 (-)
NCBI ID WP_020750951.1
RefSeq NZ_CP020659
Uniprot ID UPI0002E71C77
KEGG ID -
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-9 VRAALPDGF
Transmembrane helix 10-29 RLGLAVLGLVLLMSGIGHLF
Inside 30-50 WRDIQHEMAAVTHLADAEQAP


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9467 - -


  Protein sequence: 51 a.a.    

>T6CP015336 NZ_CP020659:c1918825-1918673 [Pseudomonas aeruginosa PAK] [TssL]
VRAALPDGFRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP*

  Nucleotide sequence: 153 bp    

>T6CP015336 NZ_CP020659:c1918825-1918673 [Pseudomonas aeruginosa PAK] [TssL]
GTGCGCGCAGCGCTGCCGGACGGCTTCCGCCTGGGCCTGGCGGTGCTCGGGCTGGTGCTGTTGATGAGCGGTATCGGACA
CCTGTTCTGGCGCGACATCCAGCACGAAATGGCGGCGGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA