SecReT6, T6SS database

Detailed information of component protein

Summary

Component ID	T6CP015314
Component protein type	TssJ
T6SS ID (Type)	T6SS01209 (Type Unknown)
Strain	Pseudomonas fluorescens strain MFE01
Replicon	chromosome
Sequence	Protein sequence (167 a.a.); Nucleotide sequence (501 bp)
Reference	[1] Decoin V, Barbey C, Bergeau D, et al. A type VI secretion system is involved in Pseudomonas fluorescens bacterial competition. PLoS One. 2014 Feb 14;9(2):e89411. doi: 10.1371/journal.pone.0089411. eCollection 2014. PMID: 24551247 [2] Decoin V, Gallique M, Barbey C, et al. A Pseudomonas fluorescens type 6 secretion system is related to mucoidy, motility and bacterial competition. BMC Microbiol. 2015 Mar 26;15:72. doi: 10.1186/s12866-015-0405-9. PMID: 25886496

Experimental investigation has been performed on this T6SS

External database links

Pfam domain hit(s)

Domain	Pfam ID	E-value	Aligned region

Transmembrane helices

Prediction	Region	Sequence
Inside	1-6	MSRRST
Transmembrane helix	7-29	AFFKTLTALTVLVLLAGCSSLSP
Outside	30-166	YSKVTKINLKLTGSDQLNPDLNGRPSPIVVRLFELKHPVTFENADFFSLYERAKESLNPDLVASEELELRPGETVELKLSVEEGSRYVGILAAYRDLPDTQWRHTVQITPLELTEADLTLDQAGIRNTQQVLAKADD

Signal peptides

Signal peptides and corresponding cleavage sites are predicted using SignalP 5.0 software.

Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).

Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).

Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).

Prediction	Probability	Cleavage site	Signal peptide sequence
LIPO(Sec/SPII)	0.9979	pos: 23-24. LAG-CS.	MSRRSTAFFKTLTALTVLVLLAG

Protein sequence: 167 a.a.

Nucleotide sequence: 501 bp