Detailed information of component protein
Summary
| Component ID | T6CP014886 |
| Component protein type | TssE |
| T6SS ID (Type) | T6SS01170  (Type i1) |
| Strain | Pectobacterium brasiliense 1692 |
| Replicon | chromosome |
| Sequence | Protein sequence (144 a.a.); Nucleotide sequence (432 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 2751421..2751852 (+) |
| NCBI ID | WP_005972060.1 |
| RefSeq | NZ_CP047495 |
| Uniprot ID | A0A1D7Z2J4_9GAMM, A0A086EV59_9GAMM, A0A0J5XFD3_9GAMM, A0A419AJ87_PECCA |
| KEGG ID | pws:A7983_12735, pbra:B5S52_05475 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-143 | MPSLSAWERGNAASLFDRIRGEERRSSPETEVEALIESVKRQLDNVLNTRPGNCRSAPELGVIDFNDATQGGADIRGKIREAIRQCICRFEPRIVHVDVDTSDYLSNPMEMSFQVTARVRLEDLEQVASFNIHMDSHRHYRMI |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.9775 | - | - |
Protein sequence: 144 a.a.
Nucleotide sequence: 432 bp