Detailed information of component protein


Summary

Component ID T6CP014823
Component protein type TssF
T6SS ID (Type) T6SS01164 experimental (Type i4b)
Strain Acinetobacter baumannii AbCAN2
Replicon chromosome
Sequence Protein sequence (604 a.a.); Nucleotide sequence (1812 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) F9K57_RS05840
Coordinate (Strand) 1216122..1217933 (+)
NCBI ID WP_000568822.1
RefSeq NZ_CP045428
Uniprot ID A0A0J0ZY45_ACIBA, A0A5N4BFA0_ACIBA, A0A7U4DFX5_ACIB5, B0VB01_ACIBY, A0A5K6CST3_ACIB3
KEGG ID abn:AB57_1483, aby:ABAYE2411, abb:ABBFA_02205
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssF PF05947.14 6.8e-146 3..599

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-603 VIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDVFTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQDVKLLPIHLSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELSKNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLKRIPQHVSELELLIHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILEMNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFISTKLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDAVSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFSQLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9964 - -



  Protein sequence: 604 a.a.    

>T6CP014823 NZ_CP045428:1216122-1217933 [Acinetobacter baumannii] [TssF]
VIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDVFTRSLFEVMF
PQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQDVKLLPIHLSGLDFKTTPSAHMHLNQNA
TLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELSKNPFELIGFAEQESLLPLDQHT
HHAYRLLMEYFCFPEKFSYLKLDLDFLKRIPQHVSELELLIHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAE
PQKIVHKQLEYPLVTDAHHPEFYQVYSILEMNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMG
YSIISKNLNPFSTRSDFISTKLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSL
NSLALMKGDAVSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL*

  Nucleotide sequence: 1812 bp    

>T6CP014823 NZ_CP045428:1216122-1217933 [Acinetobacter baumannii] [TssF]
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAACAATCTCGGGAATTTGCCCAAAAATA
TCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCACATATTGAACGTCTGATTCAGGCTTTTT
CGCTGATTGCTGCTCGAATCGATAAAAAACTAACAGATAGTTACGATGTTTTTACTCGTTCTTTATTTGAGGTGATGTTT
CCTCAATACTTACGACATTTTCCTGCGTGTTCAGTTGTTAGTTTTGAAGATATTAATAAGATTAAACAGCTTACAGAACC
TCATCTTGTACCTCATCATACGGTTTTGAAATCTCGTAGTTTCAAAGGAGTACAGTGTGAGTTTAATACAACTCAAGATG
TTAAATTACTGCCTATTCATTTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCACATATGCACTTAAATCAAAATGCG
ACGTTGAGCCTTAAATTTGAAATTTTTAATAATGCTCATGCTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGC
TATCTCTAATTTTCCTCTACAGGTCCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATATGGACAAACAA
TTGTAGAATTGAGCAAGAATCCATTCGAATTGATTGGTTTTGCAGAACAAGAAAGTTTATTACCGCTTGATCAACATACC
CATCATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTTTAGTTATCTTAAGCTCGATTTAGATTTTTT
AAAGCGAATACCTCAGCATGTATCCGAACTTGAGCTTTTAATTCATTTCAAATTAAACTTAAATGATCAAGCCGTTGTTA
GAAACTATTCTGAGCTAAATATTGCAAACTTTAAATTATTTACTACCCCAGTAATTAATTTATTTGAAAAATATGCTGAA
CCCCAGAAGATAGTTCATAAGCAATTAGAATATCCTTTAGTTACAGATGCACATCATCCTGAGTTTTATCAGGTATATTC
AATACTTGAGATGAATATGGTGCGTGAAAAAACAAATCAGGAAGAAAGCTATGTTCCTGTTTTGCCGTTTTTTGCGATGA
GCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTGAACTATCAAAAGTTACAGTCCAATTTCGTTGAAATGGGC
TATTCCATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGCACCAAATTATTATGTTCAAACCG
TGATTTACCTCATGAAGCACTGGGGCAGTCTAATAACGTATTAAATTTAAATGATAGTAGCTTGGCGAGACGTGCCATTG
TTTTAAAACGACCTACCAAGCCTTATAAGTTTGAACAAGGCCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCGTTA
AATAGCTTGGCGCTTATGAAAGGGGATGCTGTTTCTCATGTTAAAGAGCTGCTGGCTTTATATAACTTACCGCAGTCAAA
AGAAAACTATTTAATTATAGAATCAATTAAAAAATTAGAATTTTCTCTTACCCATAAACTCGTAGACGGCAAACCATTTC
CAATGTTTGTAAGAGGAGTAAAAGCTGAATTACAAATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATTATTCATCTCA
GCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTATAA