Detailed information of component protein


Summary

Component ID T6CP014340
Component protein type TssL
T6SS ID (Type) T6SS01119 experimental (Type i4b)
Strain Acinetobacter baumannii strain UPAB1
Replicon chromosome
Sequence Protein sequence (269 a.a.); Nucleotide sequence (807 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) D1G37_RS14070
Coordinate (Strand) 2964332..2965138 (+)
NCBI ID WP_000083629.1
RefSeq NZ_CP032215
Uniprot ID A0A836M1F3_ACIBA, A0A829KH67_ACIBA, A0A0J0ZX80_ACIBA, A0A427R4A1_9GAMM, A0A3R9FU43_9GAMM, V5VEM3_ACIBA, A0A7U4DFV7_ACIB5, B0VB14_ACIBY, A0A5K6CSS4_ACIB3, D0C8N1_ACIB2
KEGG ID abn:AB57_1493, abb:ABBFA_02195, aby:ABAYE2401
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 1.8e-51 35..237

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-216 MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLNRFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILEQLRSRGKERLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNIIHRELP
Transmembrane helix 217-239 FFWILIFLLIFALLTFAGLRFML
Inside 240-268 NNQNDKALSNYQNVISAPQEQAHITIYLP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9868 - -



  Protein sequence: 269 a.a.    

>T6CP014340 NZ_CP032215:2964332-2965138 [Acinetobacter baumannii] [TssL]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLNRFEQQAKKLQ
FSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILEQLRSRGKERLAALEVFHYCL
LLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNIIHRELPFFWILIFLLIFALLTFAGLRFMLN
NQNDKALSNYQNVISAPQEQAHITIYLP*

  Nucleotide sequence: 807 bp    

>T6CP014340 NZ_CP032215:2964332-2965138 [Acinetobacter baumannii] [TssL]
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAATAATAATAGCCAGTCCCA
AGTAAAGTTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTTTTTAATTCGAAATCAGTATG
TGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAATCGATTTGAGCAACAAGCGAAAAAGTTACAA
TTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTTGTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGATCC
AAGCTATTTTAATTTACAAAATTCTTGGTTAATTAGCCCATTACAGTTAAGTCTCTTTGGTTCTCAGTTAGCGGGTTATC
AATTCTTCGAAATTTTAGAGCAACTACGTAGTCGTGGAAAAGAGCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTA
TTATTAGGTTTTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCCTTCTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATTATCCATCGTG
AGTTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAGGTTTAAGGTTTATGCTTAAC
AATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCCACAAGAGCAGGCACATATTACAATTTACTT
ACCTTGA