Detailed information of component protein


Summary

Component ID T6CP014339
Component protein type TssK
T6SS ID (Type) T6SS01119 experimental (Type i4b)
Strain Acinetobacter baumannii strain UPAB1
Replicon chromosome
Sequence Protein sequence (455 a.a.); Nucleotide sequence (1365 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) D1G37_RS14065
Coordinate (Strand) 2962950..2964314 (+)
NCBI ID WP_000471444.1
RefSeq NZ_CP032215
Uniprot ID A0A829KER7_ACIBA, A0A0J0ZXY9_ACIBA, A0A427XA94_9GAMM, V5VER9_ACIBA, A0A7U3Y5B0_ACIB5, B0VB15_ACIBY, A0A5K6CS09_ACIB3
KEGG ID abb:ABBFA_02196, aby:ABAYE2402, abn:AB57_1492
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 6.3e-127 19..451

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-454 MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQDGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNATEADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKRTLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAGSLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRDTRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIEPHHELYQRMLDSETICIYVPAGFQDISIELIAVMNA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9959 - -



  Protein sequence: 455 a.a.    

>T6CP014339 NZ_CP032215:2962950-2964314 [Acinetobacter baumannii] [TssK]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQDGEIYQAPAY
DLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNATEADISLLRRRAVFKLLDAHS
NPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKRTLNVIKAKIKTIQTNNRENEQKLIEFRSGD
IVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAGSLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTI
ISSRYISIALKEIRPSYWVGSLETDKITRDTRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLI
QVPTAIPVRSGVSYFEIEPHHELYQRMLDSETICIYVPAGFQDISIELIAVMNA*

  Nucleotide sequence: 1365 bp    

>T6CP014339 NZ_CP032215:2962950-2964314 [Acinetobacter baumannii] [TssK]
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGCGAAGGTTTATTTTTAAGACCTCAACATTTCCAGATTCAAGATACCTATCA
TGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTGCCATTTTCCTATGGCGTTCAAAAACTTAGTTTTGATGAAGCAC
AGTTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAAGACGGTGAAATATATCAAGCGCCTGCTTAT
GACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATTTACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATT
ACAAGCCAATAAACAAAATTTAATCGATCAAAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCATG
ATCTGTTCACAAACGCGACAGAGGCTGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGT
AATCCTGATCATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTCGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACCTTGGTTTCAAATTTAAAAAGAACCTTGAATG
TTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAATTGAATTCCGTTCAGGTGAT
ATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCTGAGCCATTTCTTGCAATATCCGCAAATTCA
TCCGGAACGCTTATTCTTTGAATTGCTACGTTTGGCAGGTTCATTATTAACTTTCTCGACAGCTTATGAAGTTGATCAGT
TGCCTGCATATAAACATCATAATTTGCAAGAGAGCTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATT
ATTTCGAGTCGTTACATCAGTATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGAT
TACTCGAGATACCAGACTTTATATTGCTGTATCAAGTAGCGCGATGCAGACCCACGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACATCACTTAATC
CAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACCGCATCATGAACTCTATCAACGTAT
GTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATATCAGTATTGAGCTGATTGCGGTCATGAACG
CTTAA