Detailed information of component protein


Summary

Component ID T6CP014338
Component protein type TssA
T6SS ID (Type) T6SS01119 experimental (Type i4b)
Strain Acinetobacter baumannii strain UPAB1
Replicon chromosome
Sequence Protein sequence (365 a.a.); Nucleotide sequence (1095 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) D1G37_RS14060
Coordinate (Strand) 2961839..2962933 (+)
NCBI ID WP_000020713.1
RefSeq NZ_CP032215
Uniprot ID A0A7U4BMT2_ACIBA, A0A0E1PSA4_ACIBA, A0A0J0ZWX6_ACIBA, A0A3R9H647_9GAMM, A0A7U3XZA8_ACIBC, V5VG41_ACIBA, A0A7U3Y5G4_ACIB5, A0A654KYB7_ACIBM, B0VB16_ACIBY, A0A828SRY7_ACIBA, A0A5K6CS18_ACIB3, A0A385EU81_ACIBA
KEGG ID aby:ABAYE2403, abh:M3Q_1677, abw:BL01_13215, abn:AB57_1491, abc:ACICU_01308, abb:ABBFA_02197, abz:ABZJ_01466
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ImpA_N PF06812.14 5.2e-32 9..131

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-364 MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEKTKDIRLLTWVIEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKKVPLTNTAPYYNLLDYDNFLYHENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFNSVLTEWNVLKQTLDHLMGLDSPSFAAIDSAFETIHSTLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVSDQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQMVQEMLGVQPKNEYE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9969 - -



  Protein sequence: 365 a.a.    

>T6CP014338 NZ_CP032215:2961839-2962933 [Acinetobacter baumannii] [TssA]
MSIDISELLKPINDSLLCGEDYSFSNEFHEIKKARTQDDLLLDQGDWVAERKQADWDFVAKSVSTLLIEKTKDIRLLTWV
IEAWTHLNGFEGMVKGITLTHTMLNQYWQDIHPIIEDDDLDQRIGLLQGLINQLPMLLKKVPLTNTAPYYNLLDYDNFLY
HENIRRKQTEEYESQSGPSELEQFDQAIFNTSKTFQYSNYQEFNSVLTEWNVLKQTLDHLMGLDSPSFAAIDSAFETIHS
TLRKIYKAEAFGTGLAPSQEQAAVITTPSMENQVPVQIVSDQPMFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVS
YMLQKTIKWSQMPLHEWLAQVIKDEHPLQMVQEMLGVQPKNEYE*

  Nucleotide sequence: 1095 bp    

>T6CP014338 NZ_CP032215:2961839-2962933 [Acinetobacter baumannii] [TssA]
ATGAGTATTGATATTTCTGAACTACTTAAACCCATTAATGACAGCTTGCTTTGTGGTGAGGATTATTCATTTTCTAATGA
ATTTCACGAGATAAAGAAAGCCAGAACACAGGATGATCTATTATTAGATCAGGGGGATTGGGTTGCTGAACGGAAGCAGG
CAGATTGGGACTTTGTTGCGAAGAGTGTAAGCACTTTGCTCATTGAAAAAACCAAAGATATCCGTCTATTAACTTGGGTA
ATAGAAGCCTGGACTCATCTAAATGGTTTTGAAGGCATGGTAAAGGGAATCACTTTAACTCATACCATGCTGAACCAATA
TTGGCAGGATATTCATCCGATTATTGAAGATGATGATTTGGATCAGCGTATTGGTTTATTACAAGGACTTATTAATCAGT
TGCCAATGCTGTTGAAGAAAGTACCTTTAACTAACACAGCTCCTTATTATAACTTGCTTGATTACGATAATTTTCTATAT
CACGAAAATATACGCCGTAAGCAAACAGAAGAGTACGAGAGTCAGTCAGGTCCATCTGAATTAGAACAATTTGATCAAGC
GATCTTTAATACCTCTAAAACCTTTCAATACTCAAATTATCAAGAGTTTAATTCGGTTTTAACGGAGTGGAATGTTTTAA
AGCAGACACTCGACCATTTAATGGGATTAGATTCACCGAGTTTTGCTGCAATTGATTCTGCATTTGAAACAATACACAGC
ACTTTACGTAAAATTTACAAAGCAGAGGCTTTTGGTACTGGGCTTGCGCCGAGCCAAGAACAGGCCGCTGTCATCACGAC
ACCGTCTATGGAAAATCAAGTGCCTGTACAAATCGTATCAGACCAGCCTATGTTTCAGCCACAAGCACAAACTCACTTGG
CCAATCGCGAGCAAGCAATGAAAGTGCTGCAAGAAATAGCTGATTATTTTCAAGCAAATGAGCCCCATAGTCCTGTGAGC
TATATGCTCCAAAAGACCATTAAATGGAGCCAAATGCCGTTGCATGAATGGTTAGCACAAGTGATTAAAGATGAGCATCC
ATTACAAATGGTTCAGGAAATGTTAGGTGTTCAACCTAAAAATGAATATGAATAA