Detailed information of component protein


Summary

Component ID T6CP014333
Component protein type TssE
T6SS ID (Type) T6SS01119 experimental (Type i4b)
Strain Acinetobacter baumannii strain UPAB1
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) D1G37_RS14015
Coordinate (Strand) 2948338..2948814 (+)
NCBI ID WP_001047031.1
RefSeq NZ_CP032215
Uniprot ID A0A7U4F6J3_ACIBA, N9KTR7_ACIBA, A0A829KH57_ACIBA, A0A0E1PYI2_ACIBA, A0A0J0ZYC3_ACIBA, A0A3R9DYQ0_9GAMM, A0A427XA82_9GAMM, A0A7U4DCX9_ACIBC, V5VES8_ACIBA, A0A7U4DG15_ACIB5, A0A654KYE0_ACIBM, B0VB02_ACIBY, A0A828SUB7_ACIBA, A0A5K6CS19_ACIB3, D0C8P2_ACIB2, A0A385EU41_ACIBA
KEGG ID abh:M3Q_1668, abz:ABZJ_01457, abn:AB57_1482, abw:BL01_13260, aby:ABAYE2412, abc:ACICU_01299, abb:ABBFA_02206
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 4.7e-17 34..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDDYPLVKKSILQFGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVVFDALLKPTTQQYVISART



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9965 - -



  Protein sequence: 159 a.a.    

>T6CP014333 NZ_CP032215:2948338-2948814 [Acinetobacter baumannii] [TssE]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDDYPLVKKSILQFGIIDFVGLS
TANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVVFDALLKPTTQQYVISART*

  Nucleotide sequence: 477 bp    

>T6CP014333 NZ_CP032215:2948338-2948814 [Acinetobacter baumannii] [TssE]
ATGAACTTAGATCGGCTTTATCCATACGGATTTCGTTCAACTTTATTTGATCGCTTAATTCCAGAAAGTGAAGATTATGC
AAAAGGTCTTTCTATTCAGCAATTAAGAGAATCTGTAGCAAAGGATTTAGAAGATTTGCTCAATAGTCGGGTAGCAAAGT
TAGATCATGTGATTGATGACTATCCACTTGTAAAAAAATCGATACTTCAGTTCGGGATTATTGATTTTGTGGGGCTTTCT
ACAGCCAACCCTCTGGATCGGGATAAAATTTGCCAATCCATTGAGCAATCAATAGCAGCTCATGAACCTCGGCTAAGACA
AATACGGGTAGAGATGTTATTAGATGGACATAATATGGGCGCATTATGTTTAAGTATTCAGGCTTATCTAAATATTCACC
CCTTATATGAACCTGTTGTATTTGATGCATTGTTAAAACCAACAACGCAGCAATATGTAATTTCAGCAAGAACTTAA