Detailed information of component protein


Summary

Component ID T6CP014332
Component protein type TssD
T6SS ID (Type) T6SS01119 experimental (Type i4b)
Strain Acinetobacter baumannii strain UPAB1
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) D1G37_RS14010
Coordinate (Strand) 2947755..2948258 (+)
NCBI ID WP_000653195.1
RefSeq NZ_CP032215
Uniprot ID A0A0R1C1Y7_ACINO, A0A7U4F766_ACIBA, A0A009RJK0_9GAMM, A0A010KAB5_9GAMM, A0A022IZT8_9GAMM, A0A013UTK5_9GAMM, A0A013TMC1_9GAMM, A0A829KEQ7_ACIBA, A0A0E1PSF3_ACIBA, A0A0J0ZX19_ACIBA, N8S3X6_9GAMM, A0A1V2V3D7_9GAMM, A0A4R6CNR4_9GAMM, A0A3R9CCF9_9GAMM, A0A3R9GB64_9GAMM, A0A7U3XZ91_ACIBC, R9RIP4_ACIBA, A0A1A0GM72_ACICA, A0A7U3Y5A8_ACIB5, A0A143IYH8_ACIPI, A0A654KYA4_ACIBM, B0VB03_ACIBY, A0A828SRX5_ACIBA, A0A5K6CS27_ACIB3, D0C8P3_ACIB2, F0KJP8_ACICP, L9MI81_9GAMM, A0A385EU73_ACIBA
KEGG ID abc:ACICU_01298, abz:ABZJ_01456, abb:ABBFA_02207, abh:M3Q_1667, abw:BL01_13265, abn:AB57_1481, aby:ABAYE2413, acc:BDGL_000641
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5.4e-40 5..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSNNTASYAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9825 - -



  Protein sequence: 168 a.a.    

>T6CP014332 NZ_CP032215:2947755-2948258 [Acinetobacter baumannii] [TssD]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAG
YTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSN
NTASYAA*

  Nucleotide sequence: 504 bp    

>T6CP014332 NZ_CP032215:2947755-2948258 [Acinetobacter baumannii] [TssD]
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACAAAGGTTGGTT
AGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGTAGGCGGCCACACTGCTGAAC
GTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGCCCTAAATTATGGGAAGCTTGTTCAGCTGGT
TACACATTTGATGAAGTACAAATCGACTTCTATCGCGCAAATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAA
GCACGTTTTAGTTTCTAGTGTGACTCCAACTGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTG
CTGTTGAGTGGACTTATAACCAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAAT
AATACAGCTTCTTACGCAGCGTAA