Detailed information of component protein


Summary

Component ID T6CP014010
Component protein type TssB
T6SS ID (Type) T6SS01088 experimental (Type i1)
Strain Vibrio anguillarum strain MHK3
Replicon chromosome
Sequence Protein sequence (170 a.a.); Nucleotide sequence (510 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) CG015_RS14380
Coordinate (Strand) 262982..263491 (-)
NCBI ID WP_017043584.1
RefSeq NZ_CP022469
Uniprot ID A0A233HMX1_9VIBR, A0A191W9J3_VIBAN, A0A853R5K8_9VIBR
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 4e-57 6..157

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-169 MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHTEETPLEERQTVSVDKNNFEAVMRESDLKLTTTVRNKLSGDENAELPVELSFKSLADFEPDSVAAQVPELNKLVELRQALVALKGPLGNIPAFRERLQELLNSEESREKLLSELSLVSGKEEEPQA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9877 - -



  Protein sequence: 170 a.a.    

>T6CP014010 NZ_CP022469:c263491-262982 [Vibrio anguillarum] [TssB]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHTEETPLEERQTVSVDKNNFEAVMRESDLKLTTTVRNK
LSGDENAELPVELSFKSLADFEPDSVAAQVPELNKLVELRQALVALKGPLGNIPAFRERLQELLNSEESREKLLSELSLV
SGKEEEPQA*

  Nucleotide sequence: 510 bp    

>T6CP014010 NZ_CP022469:c263491-262982 [Vibrio anguillarum] [TssB]
ATGTCTAAAGAAGGAAGTGTAGCTCCTAAAGAGCGGATTAATATTAAGTATATTCCAGCAACGGGAGATGCACAGGCTGA
AGTTGAGTTACCGCTAAAAACTCTGGTGGTGGGTGATTTTAAAGGCCATACCGAAGAGACCCCACTTGAAGAGAGACAGA
CCGTTTCAGTGGACAAGAACAACTTTGAAGCGGTTATGCGTGAAAGCGATTTGAAACTGACCACTACAGTGCGCAATAAA
CTGAGTGGCGATGAAAATGCTGAGCTTCCTGTTGAGCTTAGTTTCAAATCTCTTGCTGACTTCGAACCGGATTCAGTGGC
AGCACAAGTTCCAGAATTAAATAAATTGGTTGAGCTACGCCAAGCTCTTGTGGCCTTAAAAGGTCCTTTGGGCAATATTC
CCGCGTTTAGAGAGCGTCTACAAGAGCTACTAAATTCGGAAGAATCGCGTGAAAAACTTCTATCTGAGCTAAGCCTAGTG
AGCGGCAAAGAAGAAGAGCCTCAAGCATAA