Detailed information of component protein


Summary

Component ID T6CP014009
Component protein type TssC
T6SS ID (Type) T6SS01088 experimental (Type i1)
Strain Vibrio anguillarum strain MHK3
Replicon chromosome
Sequence Protein sequence (492 a.a.); Nucleotide sequence (1476 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) CG015_RS14375
Coordinate (Strand) 261457..262932 (-)
NCBI ID WP_026027753.1
RefSeq NZ_CP022469
Uniprot ID A0A233HNL4_9VIBR, A0A191W9L9_VIBAN, A0A853R8P5_9VIBR
KEGG ID vau:VANGNB10_cII0071
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 7e-125 65..364
VipB_2 PF18945.2 6.5e-45 377..488

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-491 MSTTEAVLERQSATQGSLLDEIMAQTRIAPTEEGYDVAKKGVAAFIENLIGSNQTEEPVNKSLVDQMLVELDKKISAQMDEILHEERFQQMESSWRGLKLFIDRTDFRENNKVDLLHVTKGELLEDFEFAPETTQSGLYKHVYSSGYGQFGGEPTGAIIGNFAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIKDLKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPTENPIKSFNYVESVSASHEHYLWGNTAFAFATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLVTDRKEFELAEEGFIALTMRKGSDNAAFFSANSIQKPKIFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLERELNGWIKQYVADQENPPADVRSRRPLRAAKIEVMDVEGEPGWYQVSLSVRPHFKYMGANFELSLVGRLDQA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9897 - -



  Protein sequence: 492 a.a.    

>T6CP014009 NZ_CP022469:c262932-261457 [Vibrio anguillarum] [TssC]
MSTTEAVLERQSATQGSLLDEIMAQTRIAPTEEGYDVAKKGVAAFIENLIGSNQTEEPVNKSLVDQMLVELDKKISAQMD
EILHEERFQQMESSWRGLKLFIDRTDFRENNKVDLLHVTKGELLEDFEFAPETTQSGLYKHVYSSGYGQFGGEPTGAIIG
NFAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIKDLKSTFESPKYTKWRSLRESEDARYLGLTAP
RFLLRVPYDPTENPIKSFNYVESVSASHEHYLWGNTAFAFATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGAL
QSKIPTEVLVTDRKEFELAEEGFIALTMRKGSDNAAFFSANSIQKPKIFPNTKEGKEAETNYKLGTQLPYMMIINRLAHY
VKVLQREQIGAWKERQDLERELNGWIKQYVADQENPPADVRSRRPLRAAKIEVMDVEGEPGWYQVSLSVRPHFKYMGANF
ELSLVGRLDQA*

  Nucleotide sequence: 1476 bp    

>T6CP014009 NZ_CP022469:c262932-261457 [Vibrio anguillarum] [TssC]
ATGTCTACTACTGAAGCCGTCTTAGAGAGACAAAGTGCCACCCAAGGCAGTTTACTTGATGAAATCATGGCACAAACGCG
CATTGCACCGACTGAAGAAGGGTATGATGTTGCGAAGAAAGGGGTTGCTGCGTTTATTGAGAATCTCATCGGTTCGAATC
AAACGGAAGAGCCGGTTAACAAATCACTCGTTGATCAAATGCTGGTTGAGCTTGATAAGAAAATCAGTGCTCAAATGGAT
GAGATTTTGCACGAAGAGCGTTTCCAGCAGATGGAATCGTCATGGCGTGGTTTGAAACTGTTTATTGACCGTACCGATTT
TCGTGAAAACAACAAGGTTGATTTGTTGCATGTAACGAAAGGCGAGTTGCTTGAAGACTTTGAATTTGCACCAGAAACGA
CGCAATCTGGTCTTTATAAGCACGTTTATTCTTCTGGTTATGGCCAATTTGGTGGTGAGCCGACTGGCGCTATCATCGGT
AACTTTGCTTTCACGCCATCAACCCCTGACATGAAGCTACTGCAATACATGGGTGCACTTGGTGCGATGGCTCATGCTCC
ATTCATTTCTAGTGTAGGCCCTGAGTTTTTTGGTATCGATTCTTTTGAAGAGCTACCAAATATCAAGGATCTTAAGTCAA
CATTTGAAAGCCCTAAATACACTAAATGGCGTTCTCTACGTGAATCAGAAGATGCGCGTTACCTTGGCTTGACTGCGCCT
CGTTTCTTATTGCGCGTACCTTATGATCCAACAGAAAACCCAATTAAATCATTTAATTATGTGGAAAGTGTCAGCGCTTC
ACACGAACACTATCTATGGGGTAACACCGCGTTTGCTTTCGCTACTCGTTTAACCGATAGCTTTGCCAAGTACCGTTGGT
GTCCAAACATCATTGGCCCACAAAGTGGCGGTGCGGTTGAAGATCTGCCAGTACACGTGTTTGAATCGATGGGTGCACTG
CAAAGTAAGATCCCAACTGAAGTGTTGGTGACTGACCGTAAAGAGTTTGAATTAGCAGAAGAAGGTTTCATTGCTTTAAC
CATGCGTAAAGGCAGTGATAACGCCGCATTCTTCTCTGCAAACTCGATCCAAAAGCCAAAAATATTCCCGAATACCAAAG
AAGGCAAAGAAGCAGAAACCAACTACAAGTTGGGTACGCAACTGCCATATATGATGATCATCAATCGCCTTGCACACTAC
GTCAAAGTGCTACAGCGTGAGCAAATTGGTGCTTGGAAAGAGCGTCAAGATCTTGAACGCGAGCTTAATGGTTGGATCAA
ACAGTACGTGGCTGACCAAGAAAATCCACCAGCAGACGTACGTAGCCGTCGTCCTCTTCGTGCTGCAAAAATCGAAGTCA
TGGATGTTGAAGGTGAACCAGGTTGGTATCAGGTCTCTCTCTCTGTTCGTCCTCACTTTAAGTACATGGGCGCGAACTTT
GAATTGTCATTGGTTGGTCGATTAGATCAAGCATAA