Detailed information of component protein


Summary

Component ID T6CP014006
Component protein type TssJ
T6SS ID (Type) T6SS01088 experimental (Type i1)
Strain Vibrio anguillarum strain MHK3
Replicon chromosome
Sequence Protein sequence (160 a.a.); Nucleotide sequence (480 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) CG015_RS14350
Coordinate (Strand) 256296..256775 (-)
NCBI ID WP_013868298.1
RefSeq NZ_CP022469
Uniprot ID A0A233IFX2_9GAMM, A0A233HNE7_9VIBR, A0A223N1R5_9VIBR, A0A7Y3QV81_9VIBR, B6SDI5_VIBAN, A0A853R2Z5_9VIBR, F7YT75_VIBA7, A0A7U4CV87_VIBAN
KEGG ID vqi:CCZ37_13765, lag:N175_17370, van:VAA_02840
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 3.1e-28 31..145

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-159 VNKRSFVLLMLLTVLTACSSSEKYEPATQPTKVTFSLVSDEGTNPNIWGEASPIEVQVFELKDDSMFMSADYDQVKADYKKALRSNFIANYDYVMTPGQFKFVNAFEIDEGTNYIGVMAHFAEPELSEWKKAVKVLNKGREYHLLMYFKDYDVKLERVE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9991 pos: 17-18. LTA-CS. VNKRSFVLLMLLTVLTA



  Protein sequence: 160 a.a.    

>T6CP014006 NZ_CP022469:c256775-256296 [Vibrio anguillarum] [TssJ]
VNKRSFVLLMLLTVLTACSSSEKYEPATQPTKVTFSLVSDEGTNPNIWGEASPIEVQVFELKDDSMFMSADYDQVKADYK
KALRSNFIANYDYVMTPGQFKFVNAFEIDEGTNYIGVMAHFAEPELSEWKKAVKVLNKGREYHLLMYFKDYDVKLERVE*

  Nucleotide sequence: 480 bp    

>T6CP014006 NZ_CP022469:c256775-256296 [Vibrio anguillarum] [TssJ]
GTGAACAAGCGGTCTTTTGTCCTGCTGATGCTACTGACGGTATTAACCGCCTGTAGCTCATCAGAAAAGTATGAGCCAGC
CACACAGCCGACCAAGGTAACGTTCAGTCTCGTTAGTGATGAAGGTACTAACCCTAATATTTGGGGTGAAGCGTCGCCGA
TAGAGGTTCAAGTGTTTGAGCTCAAAGATGATTCGATGTTTATGTCTGCCGATTATGACCAAGTAAAAGCAGACTACAAA
AAAGCGTTACGCAGCAATTTTATCGCCAATTACGATTATGTAATGACACCAGGCCAGTTTAAGTTTGTGAACGCGTTCGA
GATTGATGAAGGCACGAACTACATTGGGGTCATGGCGCATTTTGCTGAACCTGAGCTGAGTGAATGGAAAAAGGCCGTAA
AAGTGCTTAACAAAGGTAGGGAATACCATCTTTTGATGTATTTCAAAGACTACGATGTAAAACTGGAAAGGGTGGAATAA