Detailed information of component protein


Summary

Component ID T6CP014005
Component protein type TssK
T6SS ID (Type) T6SS01088 experimental (Type i1)
Strain Vibrio anguillarum strain MHK3
Replicon chromosome
Sequence Protein sequence (445 a.a.); Nucleotide sequence (1335 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) CG015_RS14345
Coordinate (Strand) 254957..256291 (-)
NCBI ID WP_017044997.1
RefSeq NZ_CP022469
Uniprot ID A0A233IFS4_9GAMM, A0A233HMY4_9VIBR, A0A7Y3QW30_9VIBR, B6SDI6_VIBAN, A0A853R7X8_9VIBR, A0A7U4CVD7_VIBAN
KEGG ID lag:N175_17375, vau:VANGNB10_cII0077
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 5.8e-156 19..442

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-444 MFARNRVIWNEGLFIKPQHFQQQQRYFEYHIDERISSVSGYLYGVSELSLNPEYLSFGRIAIERAVGIMPDGTVFRIPQEDVLPDALEIADASLANQLVYLAVPLRSESLMEINWPEERGTGRYLSNRLEVRDVHTVRGDTTTLDVSPVRVQLMLEKEDRSSYASIAIARILEKRPDGSVVLDPDFIPCHLNVASNAALHRFINEISGLMRERAKNIAQRISSPSQGGVADVSDFMLLQALNRLQPQMQHLAELRSLHPERLFECLSCVCGELATFTDESRLPPSIPSYNHEMPTHSFGPLIRNLRQSLSIVLEPRAVSIQLDKRKYGLMVAPIHDPQLVESAEFIIAVKARMPLDELRRLFTQQTKVSSVEKIRELISLQLPGIPITPLPVAPRQLPYHAGYTYYQLDKTSSAWSMLGRSSGFAFHVAGAFEDLDLQFWAIRS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9945 - -



  Protein sequence: 445 a.a.    

>T6CP014005 NZ_CP022469:c256291-254957 [Vibrio anguillarum] [TssK]
MFARNRVIWNEGLFIKPQHFQQQQRYFEYHIDERISSVSGYLYGVSELSLNPEYLSFGRIAIERAVGIMPDGTVFRIPQE
DVLPDALEIADASLANQLVYLAVPLRSESLMEINWPEERGTGRYLSNRLEVRDVHTVRGDTTTLDVSPVRVQLMLEKEDR
SSYASIAIARILEKRPDGSVVLDPDFIPCHLNVASNAALHRFINEISGLMRERAKNIAQRISSPSQGGVADVSDFMLLQA
LNRLQPQMQHLAELRSLHPERLFECLSCVCGELATFTDESRLPPSIPSYNHEMPTHSFGPLIRNLRQSLSIVLEPRAVSI
QLDKRKYGLMVAPIHDPQLVESAEFIIAVKARMPLDELRRLFTQQTKVSSVEKIRELISLQLPGIPITPLPVAPRQLPYH
AGYTYYQLDKTSSAWSMLGRSSGFAFHVAGAFEDLDLQFWAIRS*

  Nucleotide sequence: 1335 bp    

>T6CP014005 NZ_CP022469:c256291-254957 [Vibrio anguillarum] [TssK]
ATGTTTGCGCGTAATCGTGTCATTTGGAATGAAGGTCTATTCATTAAACCGCAGCATTTCCAGCAGCAGCAACGCTATTT
TGAATATCATATTGATGAACGCATCTCATCAGTCAGTGGCTACCTTTACGGAGTATCAGAGTTATCACTTAACCCTGAAT
ATCTCTCTTTTGGCCGTATCGCGATCGAACGTGCGGTCGGCATTATGCCTGATGGAACCGTTTTCCGTATTCCTCAGGAA
GATGTGTTGCCCGATGCGCTCGAGATTGCCGATGCTTCGCTTGCAAACCAGTTGGTCTATTTAGCGGTGCCACTTCGCAG
TGAATCGTTAATGGAGATTAACTGGCCCGAAGAGCGTGGAACAGGGCGTTACTTAAGCAATCGTTTAGAAGTGCGTGATG
TGCATACCGTGCGTGGTGACACCACGACGCTAGATGTCTCACCTGTTCGTGTGCAGTTGATGCTTGAAAAAGAAGACAGA
AGCTCTTATGCCTCAATTGCGATCGCTCGTATTTTAGAAAAACGTCCTGATGGCAGTGTCGTGCTCGATCCGGATTTTAT
TCCGTGCCATCTTAATGTTGCGAGCAATGCGGCTTTGCACCGTTTTATTAACGAAATCTCTGGGTTAATGCGCGAACGTG
CCAAAAACATTGCTCAACGTATCAGCTCTCCCTCTCAAGGCGGGGTCGCGGATGTGTCTGACTTTATGTTGTTGCAAGCC
CTGAATCGCTTACAACCCCAGATGCAACACTTGGCAGAGCTACGCAGTTTGCACCCGGAACGTTTATTTGAGTGCCTGTC
ATGCGTATGTGGAGAATTGGCTACATTTACCGATGAAAGTCGTTTACCACCGAGCATCCCGAGCTACAACCATGAAATGC
CGACCCACTCTTTTGGGCCGCTGATCCGCAACTTAAGACAGAGCCTAAGTATCGTACTTGAGCCTAGAGCGGTCTCGATT
CAGTTGGATAAACGTAAGTACGGCCTGATGGTTGCCCCAATCCACGACCCTCAACTAGTTGAAAGCGCAGAATTCATCAT
CGCGGTGAAAGCACGCATGCCATTAGATGAACTGCGTCGTCTCTTTACTCAGCAGACCAAAGTATCGTCAGTGGAGAAAA
TCCGCGAGCTCATTTCACTGCAATTACCGGGCATTCCAATTACACCGTTACCAGTGGCACCAAGGCAGCTGCCTTACCAC
GCCGGTTATACCTATTACCAATTGGATAAAACCAGCTCAGCATGGTCGATGTTAGGTCGCTCAAGTGGTTTTGCTTTCCA
TGTCGCGGGTGCGTTTGAAGATCTTGACCTGCAATTCTGGGCGATTAGGAGCTGA