Detailed information of component protein


Summary

Component ID T6CP014004
Component protein type TssL
T6SS ID (Type) T6SS01088 experimental (Type i1)
Strain Vibrio anguillarum strain MHK3
Replicon chromosome
Sequence Protein sequence (258 a.a.); Nucleotide sequence (774 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) CG015_RS14340
Coordinate (Strand) 254181..254954 (-)
NCBI ID WP_026027751.1
RefSeq NZ_CP022469
Uniprot ID A0A233IF24_9GAMM, A0A233HP09_9VIBR, A0A7Y3QVB3_9VIBR
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 5e-62 39..240

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-219 MAIDKKNTQYSGLLFDSVEQINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRSLSECDNIEQIYKQTVEEIKAIEIELAEQGFEHAILMAYRYILCAFLDEAVMGTEWGASSVWAEHSMLSRFHSETWGGEKVFTILSRLEGEPKRYRALLEFIYQCLVLGFEGKYRVMESGHNEREKVISRLHDTVSSLDENEPKELTSATDHVVKSKYKLSRQLP
Transmembrane helix 220-242 VWSVLLGFVIIWVGVFLGYSYLL
Outside 243-257 HSQSADVLNQLNQIL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9948 - -



  Protein sequence: 258 a.a.    

>T6CP014004 NZ_CP022469:c254954-254181 [Vibrio anguillarum] [TssL]
MAIDKKNTQYSGLLFDSVEQINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRSLSECDNIEQIYKQTVEEIKAIEIEL
AEQGFEHAILMAYRYILCAFLDEAVMGTEWGASSVWAEHSMLSRFHSETWGGEKVFTILSRLEGEPKRYRALLEFIYQCL
VLGFEGKYRVMESGHNEREKVISRLHDTVSSLDENEPKELTSATDHVVKSKYKLSRQLPVWSVLLGFVIIWVGVFLGYSY
LLHSQSADVLNQLNQIL*

  Nucleotide sequence: 774 bp    

>T6CP014004 NZ_CP022469:c254954-254181 [Vibrio anguillarum] [TssL]
ATGGCCATTGATAAAAAAAACACCCAATACAGCGGTCTGCTTTTTGACAGCGTCGAGCAGATCAACCACGACCAAGATTA
CTGGTTTCAACTGCGTGGTGATAACCCTAATGTTTTGATTGATGCTGCTACCCCTCTGTTTGGTTTGTCGCTGCGGGTAC
GCAGCTTGTCAGAGTGCGACAACATTGAGCAGATCTACAAACAGACGGTAGAAGAGATTAAAGCGATTGAAATCGAGCTT
GCCGAGCAAGGGTTTGAGCACGCGATTTTGATGGCTTATCGCTACATTCTGTGTGCGTTTTTGGATGAAGCCGTCATGGG
AACCGAGTGGGGAGCATCCAGTGTGTGGGCTGAACATTCTATGCTGTCTCGTTTCCACAGTGAGACTTGGGGCGGCGAAA
AAGTGTTTACCATCTTAAGTCGCTTGGAAGGTGAACCTAAACGTTATCGCGCGTTGCTAGAGTTTATCTATCAATGCCTA
GTGTTAGGTTTTGAAGGTAAATACCGTGTGATGGAAAGCGGTCACAATGAGCGTGAAAAGGTGATCAGTCGTTTACATGA
CACCGTCAGTTCGTTGGATGAAAACGAGCCGAAGGAACTGACCTCCGCCACGGACCATGTGGTGAAATCAAAATATAAGT
TAAGCAGGCAGTTACCGGTTTGGTCAGTACTGCTTGGTTTTGTCATTATTTGGGTCGGTGTGTTTTTAGGCTATTCCTAT
TTACTGCACAGCCAATCGGCAGACGTATTAAACCAATTGAACCAAATACTCTAA