Detailed information of component protein


Summary

Component ID T6CP013813
Component protein type TssK
T6SS ID (Type) T6SS01070 insolico (Type i4b)
Strain Acinetobacter baumannii ATCC 17978
Replicon chromosome
Sequence Protein sequence (455 a.a.); Nucleotide sequence (1365 bp)
Reference
-
insolico Bioinformatics investigation has been performed on this T6SS

External database links

Locus tag (Gene) AUO97_RS14030
Coordinate (Strand) 2953958..2955322 (+)
NCBI ID WP_000471450.1
RefSeq NZ_CP018664
Uniprot ID A0A0E1FFB9_ACIBA, A0A3R9CPQ8_9GAMM
KEGG ID abau:IX87_03910, abk:LX00_06470
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1e-126 19..451

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
- -



  Protein sequence: 455 a.a.    

>T6CP013813 NZ_CP018664:2953958-2955322 [Acinetobacter baumannii] [TssK]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQDGEIYQAPAY
DLLPEPILLDELNLRGEMVIYLALPVLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNATEADISLLRRRAVFKLLDAHS
NPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKRTLNVIKAKIKTIQTNNRENEQKLIEFRSGD
IVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAGSLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTI
ISSRYISIALKEIRPSYWVGSLETDKITRDTRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLI
QVPTAIPVRSGVSYFEIEPHHELYQRMLDSETICIYVPAGFQDISIELIAVMNA*

  Nucleotide sequence: 1365 bp    

>T6CP013813 NZ_CP018664:2953958-2955322 [Acinetobacter baumannii] [TssK]
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGTGAAGGTTTATTTTTAAGACCTCAACATTTCCAGATTCAAGATACCTATCA
TGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTTCCATTTTCCTATGGCGTTCAAAAACTTAGTTTTGATGAAGCAC
AGCTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAAGACGGTGAAATATATCAAGCGCCTGCTTAT
GACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATTTACGTGGTGAGATGGTCATCTATTTGGCATTACCAGTATT
ACAAGCCAATAAACAAAATTTAATCGATCAAAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCATG
ATCTGTTCACAAACGCGACAGAGGCCGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGT
AATCCTGATCATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTTGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACCTTGGTTTCAAATTTAAAAAGAACCTTGAATG
TTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAATTGAATTCCGTTCAGGTGAT
ATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCTGAGCCATTTCTTGCAATATCCGCAAATTCA
TCCGGAACGATTATTCTTTGAATTGCTACGTTTAGCAGGTTCATTATTAACTTTCTCGACAGCTTATGAAGTTGATCAGT
TGCCTGCATATAAACATCATAATTTGCAAGAGAGCTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATT
ATTTCGAGTCGTTACATCAGTATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGAT
TACTCGAGATACCAGACTTTATATTGCTGTATCAAGTAGCGCGATGCAGACCCACGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACATCACTTAATC
CAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACCGCATCATGAACTCTATCAACGTAT
GTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATATCAGTATTGAGCTGATTGCGGTCATGAACG
CTTAA