Detailed information of component protein


Summary

Component ID T6CP013737
Component protein type TssK
T6SS ID (Type) T6SS01063 experimental (Type i3)
Strain Bradyrhizobium japonicum strain J5
Replicon chromosome
Sequence Protein sequence (450 a.a.); Nucleotide sequence (1350 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BKD09_RS17270
Coordinate (Strand) 3568189..3569538 (+)
NCBI ID WP_155795014.1
RefSeq NZ_CP017637
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1.8e-137 23..444

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-449 VDVGMSWYSKVFWSEGLFLRPHHLQQNDRYIEHLLEKRVRYTTPYPWGFAQLEIDKDLTEQSKFAVRNASGVMPDGTPFDIPADSQIPEAIDVPETAAGQVVWLMMPVAAPNTREVDEERTDSASRYVRSSETFIDSTSALRIEEEIDIAYPRLSFELRKSSKPGYMGLGIARILEVRDKNILFDDKFVPPMLICAAHPIIDGWLNRIIGWVETKLDELARYAVDPSSGGGLQSVDYLVLQVLNRTIPVLTHFQRSGSVHPERLYEELLRFAGELATFSTAERRARNYPAYDHDDLENVFTPLVSDIQDFLSARLGRRAIRLEIIERAQNAFVSPIRDRALFRNATLVLEVAARRPLVEIQNDFPHLFKVGPNTKMNEIVHANLPGLTLAHLPTPPPHIRAITDHVYFYLDRKSPLWPEFSTAASIGMHFSGDWPELELYLWAILEDRP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9956 - -



  Protein sequence: 450 a.a.    

>T6CP013737 NZ_CP017637:3568189-3569538 [Bradyrhizobium japonicum] [TssK]
VDVGMSWYSKVFWSEGLFLRPHHLQQNDRYIEHLLEKRVRYTTPYPWGFAQLEIDKDLTEQSKFAVRNASGVMPDGTPFD
IPADSQIPEAIDVPETAAGQVVWLMMPVAAPNTREVDEERTDSASRYVRSSETFIDSTSALRIEEEIDIAYPRLSFELRK
SSKPGYMGLGIARILEVRDKNILFDDKFVPPMLICAAHPIIDGWLNRIIGWVETKLDELARYAVDPSSGGGLQSVDYLVL
QVLNRTIPVLTHFQRSGSVHPERLYEELLRFAGELATFSTAERRARNYPAYDHDDLENVFTPLVSDIQDFLSARLGRRAI
RLEIIERAQNAFVSPIRDRALFRNATLVLEVAARRPLVEIQNDFPHLFKVGPNTKMNEIVHANLPGLTLAHLPTPPPHIR
AITDHVYFYLDRKSPLWPEFSTAASIGMHFSGDWPELELYLWAILEDRP*

  Nucleotide sequence: 1350 bp    

>T6CP013737 NZ_CP017637:3568189-3569538 [Bradyrhizobium japonicum] [TssK]
GTGGATGTAGGAATGTCTTGGTACAGCAAAGTTTTCTGGTCGGAAGGTCTGTTTCTGCGGCCGCATCATCTGCAGCAGAA
CGACCGCTACATCGAACACTTGCTGGAAAAGCGCGTTCGCTACACGACACCATACCCGTGGGGCTTTGCCCAGCTGGAGA
TCGACAAGGACCTTACCGAACAGAGCAAGTTCGCGGTGCGCAATGCGTCCGGCGTCATGCCGGACGGTACGCCGTTCGAT
ATCCCTGCGGACAGCCAAATTCCCGAAGCGATCGATGTGCCGGAGACGGCCGCAGGCCAGGTCGTCTGGCTGATGATGCC
GGTCGCGGCGCCAAACACCCGCGAGGTCGACGAGGAACGCACCGACAGCGCCAGTCGTTATGTTCGTAGTTCGGAAACCT
TCATTGACTCGACCTCTGCGCTACGCATCGAGGAAGAGATCGACATCGCTTATCCGCGCTTGTCGTTCGAACTGCGCAAG
AGCAGCAAGCCCGGATACATGGGCCTCGGCATCGCGCGCATTCTTGAGGTGCGCGACAAGAACATCCTGTTCGACGATAA
ATTCGTGCCGCCGATGCTGATCTGCGCCGCGCATCCGATCATCGATGGCTGGCTCAACCGCATCATCGGCTGGGTTGAGA
CTAAACTCGACGAGCTGGCGCGTTACGCGGTCGATCCGTCATCCGGCGGTGGGTTGCAGAGCGTCGACTATCTGGTCCTG
CAAGTGCTGAACCGTACCATTCCCGTCCTGACTCATTTCCAGCGCTCCGGCAGCGTGCACCCCGAGCGCCTGTACGAGGA
ATTGCTGAGATTCGCGGGCGAACTTGCGACGTTTTCAACGGCGGAACGGCGGGCGCGCAACTATCCGGCTTACGATCACG
ACGATCTCGAGAACGTCTTCACACCCTTGGTGAGCGACATCCAGGACTTCTTGAGCGCGCGATTGGGCCGGCGTGCGATC
CGCCTGGAGATCATCGAGCGCGCACAGAATGCGTTCGTGTCGCCGATCCGCGATCGAGCGCTATTCCGAAACGCGACCCT
GGTGCTGGAGGTTGCCGCACGGCGGCCGCTCGTGGAGATCCAGAACGATTTCCCGCACCTGTTCAAGGTCGGGCCGAACA
CCAAGATGAACGAGATCGTGCACGCAAACTTGCCGGGCCTGACCTTGGCGCATTTGCCGACGCCGCCGCCGCACATCCGG
GCCATCACGGATCACGTCTATTTCTATCTCGACCGTAAGTCGCCGCTGTGGCCCGAGTTCAGCACGGCGGCCTCGATCGG
AATGCATTTCTCCGGCGACTGGCCGGAGCTTGAGCTGTACCTTTGGGCCATCCTGGAAGACAGGCCATGA