Detailed information of component protein


Summary

Component ID T6CP013552
Component protein type TssB
T6SS ID (Type) T6SS01046 experimental (Type i4b)
Strain Acinetobacter baumannii ATCC 17978
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ACX60_RS11675
Coordinate (Strand) 2452539..2453042 (-)
NCBI ID WP_001119042.1
RefSeq NZ_CP012004
Uniprot ID A0A0J1D543_ACIBA, A0A0R1C0C6_ACINO, A0A1Y5NV68_ACINO, A0A372I5Z9_9GAMM, A0A385EU23_ACIBA, A0A3R9GCK7_9GAMM, A0A654KXY3_ACIBM, A0A656HYB6_ACIBA, A0A656LAP4_ACIBA, B0VB05_ACIBY, D0C8P5_ACIB2, L9MHM8_9GAMM, N9GK78_ACIBA, R9RIN9_ACIBA
KEGG ID abw:BL01_13275, abz:ABZJ_01454, aby:ABAYE2415
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 1e-59 12..164

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-167 MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9973 - -



  Protein sequence: 168 a.a.    

>T6CP013552 NZ_CP012004:c2453042-2452539 [Acinetobacter baumannii] [TssB]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNIDEVMESLSPR
AAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKL
SAEADHE*

  Nucleotide sequence: 504 bp    

>T6CP013552 NZ_CP012004:c2453042-2452539 [Acinetobacter baumannii] [TssB]
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCACGTGTTCAGCTTACATATGATGTCGAAAT
TGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTCAGCTGCATCTGAGCTTGAGC
GTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATTGATGAAGTAATGGAATCTCTGTCTCCAAGA
GCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCGGTAAAATGGCTGTTGATTTAACATTTAAATCAATGGAAGA
TTTTCGCCCGGAAAATGTTGTACAGCAAGTTGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAA
GAAACAAAATTTCAAACAGTGAGCGTTTAGAAGATCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTA
AGTGCGGAGGCCGATCATGAATAA