Detailed information of component protein


Summary

Component ID T6CP013551
Component protein type TssC
T6SS ID (Type) T6SS01046 experimental (Type i4b)
Strain Acinetobacter baumannii ATCC 17978
Replicon chromosome
Sequence Protein sequence (494 a.a.); Nucleotide sequence (1482 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ACX60_RS11670
Coordinate (Strand) 2451065..2452546 (-)
NCBI ID WP_001066525.1
RefSeq NZ_CP012004
Uniprot ID UPI0001785DE0
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 1.1e-136 66..368
VipB_2 PF18945.2 6e-45 378..488

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-493 MNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIAEIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLFKKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVSAAAHAPFISAASPSILGLESFTDIDRPRDVSKIFETAEYVQWRSFRDSEDSRYVALTLPHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAAYAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPLVHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEAFLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLVTELPQSSN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9838 - -



  Protein sequence: 494 a.a.    

>T6CP013551 NZ_CP012004:c2452546-2451065 [Acinetobacter baumannii] [TssC]
MNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIAEIDALISKQL
SQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLFKKIYEEEYGSFGGAPYSALI
GDFEFDRTPSDMYLLEQISHVSAAAHAPFISAASPSILGLESFTDIDRPRDVSKIFETAEYVQWRSFRDSEDSRYVALTL
PHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAAYAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQ
DGEVVFKCPTEIAITDRREKELSDLGFIPLVHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHY
LKAMMRDKVGSFASAGNVEAFLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSV
SLRLVTELPQSSN*

  Nucleotide sequence: 1482 bp    

>T6CP013551 NZ_CP012004:c2452546-2451065 [Acinetobacter baumannii] [TssC]
ATGAATAATACTCAATCAGCAGCAATGCCACTTGTTGAAAATGAAGAAGTTAATCTTTTAGATTCGATTGTTGAACAAAG
CCGTATTGCACGAAATGAAGAAGAACATTCTCGTGCTAAAAGCTTAATTGGTGAGCTCGCTAAAGAAGTAATGGCAGGAA
CCATTACTGTTTCTGAAAATATGACTTTATCAATTGATAAGCGTATTGCAGAAATTGATGCTCTGATTTCAAAGCAGTTA
AGTCAGATCATGCACAATGAACAATTCCAAAAAATTGAGTCAACTTGGCGTGGTCTTTATTACTTTTGTCAGGAAACGCC
TTCAAATCCGCTCATTAAAATTCGTATGCTTAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGTGCTACAGACT
TTGATCAAAGCACTTTGTTTAAGAAAATCTACGAAGAAGAATACGGTTCTTTTGGTGGTGCACCATACTCAGCATTAATT
GGTGATTTTGAGTTTGATCGTACTCCATCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTTCAGCGGCAGCACATGC
ACCATTTATTTCAGCTGCTAGTCCGAGCATTTTAGGCCTTGAATCATTTACAGATATTGATCGTCCTAGAGATGTTTCAA
AAATCTTTGAAACCGCTGAATATGTTCAATGGCGTTCGTTCCGTGATAGTGAAGACTCACGTTATGTTGCATTGACTTTA
CCTCATGTCTTGGGTCGTCTCCCATATCATCCAAAAGAAGGTACTGCGACAGAAGGCTTTAATTTTATTGAAGATGTTTC
TGGTGAAAACCACAATGAATATTTGTGGATGAATGCAGCTTATGCTTTTGGTACTCGCTTAACAAATGCATTTGATATGC
ATGGTTGGTGTGCTGCTATTCGCGGTGTTGAAGGTGGTGGTTTAGTTGAAGGCTTGCCAGTACATACTTTTAAAACACAA
GATGGCGAAGTGGTATTCAAGTGTCCAACTGAAATTGCAATCACGGATCGCCGTGAAAAAGAGTTAAGCGATCTAGGTTT
CATTCCGTTAGTACATTGTAAAAATACAGATTACGCAGCTTTCTTTGGCGCGCAATCAACTCAAAAACCTAAAAAATATG
ACAATGATACAGCCAATGCAAACTCGGCTTTATCAAGTCAGATTCAGTACATCATGGCTGTTTCACGTATTGCTCATTAC
TTAAAAGCAATGATGCGAGATAAAGTGGGTAGCTTTGCTTCTGCTGGAAATGTTGAAGCATTCTTAAATGAGTGGTTGTC
ACAGTATGTCTTACTTGACGATGGTGCTTCTCAAGAAGCGAAAGCTCAATACCCGTTACGTGAAGCGTCTGTAAAAGTTG
TAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGTTTTCTTGCGACCACATTTCCAGCTGGATGAGTTGTCGGTT
TCTTTACGACTTGTCACTGAGTTACCTCAGTCCTCAAATTAA