Detailed information of component protein


Summary

Component ID T6CP013543
Component protein type TssK
T6SS ID (Type) T6SS01046 experimental (Type i4b)
Strain Acinetobacter baumannii ATCC 17978
Replicon chromosome
Sequence Protein sequence (455 a.a.); Nucleotide sequence (1365 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ACX60_RS11610
Coordinate (Strand) 2434452..2435816 (-)
NCBI ID WP_000471450.1
RefSeq NZ_CP012004
Uniprot ID A0A0E1FFB9_ACIBA, A0A3R9CPQ8_9GAMM
KEGG ID abau:IX87_03910, abk:LX00_06470
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1e-126 19..451

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-454 MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQDGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPVLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNATEADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKRTLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAGSLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRDTRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIEPHHELYQRMLDSETICIYVPAGFQDISIELIAVMNA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9959 - -



  Protein sequence: 455 a.a.    

>T6CP013543 NZ_CP012004:c2435816-2434452 [Acinetobacter baumannii] [TssK]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQDGEIYQAPAY
DLLPEPILLDELNLRGEMVIYLALPVLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNATEADISLLRRRAVFKLLDAHS
NPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKRTLNVIKAKIKTIQTNNRENEQKLIEFRSGD
IVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAGSLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTI
ISSRYISIALKEIRPSYWVGSLETDKITRDTRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLI
QVPTAIPVRSGVSYFEIEPHHELYQRMLDSETICIYVPAGFQDISIELIAVMNA*

  Nucleotide sequence: 1365 bp    

>T6CP013543 NZ_CP012004:c2435816-2434452 [Acinetobacter baumannii] [TssK]
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGTGAAGGTTTATTTTTAAGACCTCAACATTTCCAGATTCAAGATACCTATCA
TGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTTCCATTTTCCTATGGCGTTCAAAAACTTAGTTTTGATGAAGCAC
AGCTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAAGACGGTGAAATATATCAAGCGCCTGCTTAT
GACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATTTACGTGGTGAGATGGTCATCTATTTGGCATTACCAGTATT
ACAAGCCAATAAACAAAATTTAATCGATCAAAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCATG
ATCTGTTCACAAACGCGACAGAGGCCGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGT
AATCCTGATCATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTTGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACCTTGGTTTCAAATTTAAAAAGAACCTTGAATG
TTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAATTGAATTCCGTTCAGGTGAT
ATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCTGAGCCATTTCTTGCAATATCCGCAAATTCA
TCCGGAACGATTATTCTTTGAATTGCTACGTTTAGCAGGTTCATTATTAACTTTCTCGACAGCTTATGAAGTTGATCAGT
TGCCTGCATATAAACATCATAATTTGCAAGAGAGCTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATT
ATTTCGAGTCGTTACATCAGTATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGAT
TACTCGAGATACCAGACTTTATATTGCTGTATCAAGTAGCGCGATGCAGACCCACGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACATCACTTAATC
CAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACCGCATCATGAACTCTATCAACGTAT
GTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATATCAGTATTGAGCTGATTGCGGTCATGAACG
CTTAA