Detailed information of component protein


Summary

Component ID T6CP013404
Component protein type TssA
T6SS ID (Type) T6SS01034 experimental (Type i1)
Strain Escherichia coli PCN033
Replicon chromosome
Sequence Protein sequence (472 a.a.); Nucleotide sequence (1416 bp)
Reference
[1] Peng Y, Wang X, Shou J, et al. Roles of Hcp family proteins in the pathogenesis of the porcine extraintestinal pathogenic Escherichia coli type VI secretion system. Sci Rep. 2016 May 27;6:26816. doi: 10.1038/srep26816. PMID: 27229766
[2] Zong B, Zhang Y, Wang X, et al. Characterization of multiple type-VI secretion system (T6SS) VgrG proteins in the pathogenicity and antibacterial activity of porcine extra-intestinal pathogenic Escherichia coli. Virulence. 2019 Dec;10(1):118-132. doi: 10.1080/21505594.2019.1573491. PMID: 30676217
[3] Hu L, Wang C, Lu W, et al. BaeSR activates type VI secretion system expression in porcine extra-intestinal pathogenic Escherichia coli to enhance bacterial resistance to zinc stress. Microb Pathog. 2020 Oct;147:104357. doi: 10.1016/j.micpath.2020.104357. Epub 2020 Jun 27. PMID: 32603765
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene)
Coordinate (Strand) 251512..252927 (-)
NCBI ID WP_001240540.1
RefSeq NZ_CP006632
Uniprot ID A0A792T5C9_ECOLX
KEGG ID -
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-471 MAMDLRDPNVWMSHLMENLQEEKLASALKDDTPDWEYIDGEIVKLGSLAHSQLDIPELQRRGLVLLASESKDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWVVAAPQNMAHKKRFASQVIKRFATGIEGFSQNAATAQRDALLGELAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAVPAPVPTLAASGSSPQTTTTSESGVTQTSTPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRYALWQSITSTPQAESDGRTPLAAVSADMVADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCISAQTAHRLGYTAAADAIRDEVVSFLGRLPALADLLFNDRTPFVSEKTKQWLASQAGNPAAPVIQASNEDIQAARACFDEHGLEAALRYLNTLPDGDPRNQFHRQYFSAQLMEEAGLIQLAQQQYRMLFRLAGEMMVIDWEPSLLTQLEQKFTAEY


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9970 - -


  Protein sequence: 472 a.a.    


  Nucleotide sequence: 1416 bp