Detailed information of component protein
Summary
| Component ID | T6CP013397 |
| Component protein type | TssJ |
| T6SS ID (Type) | T6SS01033  (Type i3) |
| Strain | Serratia sp. FS14 |
| Replicon | chromosome |
| Sequence | Protein sequence (169 a.a.); Nucleotide sequence (507 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 2847345..2847851 (+) |
| NCBI ID | WP_004935335.1 |
| RefSeq | NZ_CP005927 |
| Uniprot ID | UPI0002B89ACF |
| KEGG ID | - |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Inside | 1-4 | MVKT |
| Transmembrane helix | 5-27 | LRGVAAGGLLAVGMLGGCSWFSH |
| Outside | 28-168 | DEAADAGRRLRFIDVEVTANDNVNPNAAGEAQPVKVCVIETNRSGWMPEGIGDGAPCRETAPSEGALSRHQSILQPRETLRYRFEVPAGQERWVVVGAEFQQISGVLPLAEQKSPAQADSQMKVMVGMTSLSIVTNDKMDE |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| LIPO(Sec/SPII) | 0.9973 | pos: 21-22. LGG-CS. | MVKTLRGVAAGGLLAVGMLGG |
Protein sequence: 169 a.a.
Nucleotide sequence: 507 bp