Detailed information of component protein


Summary

Component ID T6CP013060
Component protein type TssB
T6SS ID (Type) T6SS01292 experimental (Type i3)
Strain Burkholderia pseudomallei K96243
Replicon chromosome II
Sequence Protein sequence (193 a.a.); Nucleotide sequence (579 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AQ15_4685
Coordinate (Strand) 1465959..1466537 (-)
NCBI ID AJX24665.1
GenBank CP009537
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 4e-56 16..165

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-192 MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLPFVMGVIADLAGKRAEPLPDLPERKFLEIDVDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLDARTELSNLLSYMDGKHGAEQLIENAINDPALLASLVRQPLAADAEGGARQPVTGTEDDPEIRHE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9932 - -



  Protein sequence: 193 a.a.    

>T6CP013060 CP009537:c1466537-1465959 [Burkholderia pseudomallei K96243] [TssB]
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLPFVMGVIADLAGKRAEPLPDLPERKFLEIDVDNFDERMKS
IAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLDARTELSNLLSYMDGKHGAEQLIENAINDPALL
ASLVRQPLAADAEGGARQPVTGTEDDPEIRHE*

  Nucleotide sequence: 579 bp    

>T6CP013060 CP009537:c1466537-1465959 [Burkholderia pseudomallei K96243] [TssB]
ATGACGAGCAAGTACAAGGCTTCGGCCAGCGGACAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATCGAGTA
CGACGTCGAGACCTACGGCGCCGAGCGCAAGGTCCAACTGCCGTTCGTGATGGGCGTGATCGCGGATCTCGCGGGCAAGC
GGGCCGAGCCGCTGCCGGACTTGCCGGAGCGCAAGTTCCTCGAAATCGACGTCGACAATTTCGACGAGCGGATGAAATCG
ATCGCGCCGCGCGTCGCGTTCCAGGTGCCGAACACGCTGTCGGGAGACGGCATGCTGAGCGTCGACATGACGTTCGAGAG
CATCGACGATTTCTCGCCCGCCGCGATCGCGCGCAACGTCGACGCGTTGCGGCGCCTGCTCGACGCGCGCACCGAGCTGT
CGAACCTGCTGTCGTACATGGACGGCAAGCACGGCGCCGAGCAACTGATCGAAAACGCGATCAACGATCCGGCACTGCTG
GCCTCGCTCGTGCGGCAGCCGCTCGCGGCGGACGCCGAAGGCGGCGCGCGGCAGCCCGTGACCGGCACCGAAGACGACCC
GGAGATTCGCCATGAATGA