Detailed information of component protein
Summary
| Component ID | T6CP012916 |
| Component protein type | TssJ |
| T6SS ID (Type) | T6SS00928  (Type i1) |
| Strain | Campylobacter jejuni 108 |
| Replicon | chromosome |
| Sequence | Protein sequence (149 a.a.); Nucleotide sequence (447 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 7489..7935 (-) |
| NCBI ID | 510027007 |
| GenBank | JX436460 |
| Uniprot ID | R9TJM7_CAMJU |
| KEGG ID | - |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-148 | MFCKKSLFFLLPLFFCACSSVVSVKINNVENSNLNNRHDDVPVTAIVYQLKDIKKFEEASDIDLATREEGVLGKDKLDSIKTQIAPKDNIIAVKVDEEEVPYVGILVLFANNTKKTTKIWAKTEDANGFGKNKYLKFEISKEGIKRIK |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| LIPO(Sec/SPII) | 0.9948 | pos: 17-18. FCA-CS. | MFCKKSLFFLLPLFFCA |
Protein sequence: 149 a.a.
Nucleotide sequence: 447 bp