Detailed information of component protein


Summary

Component ID T6CP012788
Component protein type TagJ
T6SS ID (Type) T6SS00395 experimental (Type i3)
Strain Enterobacter cloacae subsp. cloacae ATCC 13047
Replicon chromosome
Sequence Protein sequence (271 a.a.); Nucleotide sequence (813 bp)
Reference
[1] Whitney JC, Beck CM, Goo YA, et al. Genetically distinct pathways guide effector export through the type VI secretion system. Mol Microbiol. 2014 May;92(3):529-42. doi: 10.1111/mmi.12571. Epub 2014 Mar 28. PMID: 24589350
[2] Zhang H, Zhang H, Gao ZQ, et al. Structure of the type VI effector-immunity complex (Tae4-Tai4) provides novel insights into the inhibition mechanism of the effector by its immunity protein. J Biol Chem. 2013 Feb 22;288(8):5928-39. doi: 10.1074/jbc.M112.434357. Epub 2013 Jan 3. PMID: 23288853
[3] Zhang H, Gao ZQ, Wei Y, et al. Insights into the cross-immunity mechanism within effector families of bacteria type VI secretion system from the structure of StTae4-EcTai4 complex. PLoS One. 2013 Sep 2;8(9):e73782. doi: 10.1371/journal.pone.0073782. eCollection 2013. PMID: 24023903
[4] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806
[5] Soria-Bustos J, Ares MA, Gómez-Aldapa CA, et al. Two Type VI Secretion Systems of Enterobacter cloacae Are Required for Bacterial Competition, Cell Adherence, and Intestinal Colonization. Front Microbiol. 2020 Sep 24;11:560488. doi: 10.3389/fmicb.2020.560488. eCollection 2020. PMID: 33072020
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ECL_RS07585
Coordinate (Strand) 1567977..1568789 (+)
NCBI ID WP_013096187.1
RefSeq NC_014121
Uniprot ID A0A0M7ENV4_ENTCL, A0A0H3CIJ7_ENTCC
KEGG ID enc:ECL_01547, eclg:EC036_25960
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ImpE PF07024.15 1.8e-40 141..259

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-270 MNTLYQHLAGESLSDALVRLENEIKARPADADLRAAFVQFLTLSGNWTRALTQLKSWLALKPQAKPTVTLLEQCIQGELQRAQVMAGERRPAMPEAQWPWLTTLAAALSESDERAHALRLEALEQAQASAGQWTLENDETQTFEWLMDGDARLGPVCETLVNGRYFWLPFSAIAEIRFQTPASVTDLVWRHALVRLTDGTEQVCQIPARYPFAADASDAVKLARTTEWLPLDDDGTLYEGLGQKAWLSEQSESPLLSLSLVTFATDGAHE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9889 - -



  Protein sequence: 271 a.a.    

>T6CP012788 NC_014121:1567977-1568789 [Enterobacter cloacae subsp. cloacae ATCC 13047] [TagJ]
MNTLYQHLAGESLSDALVRLENEIKARPADADLRAAFVQFLTLSGNWTRALTQLKSWLALKPQAKPTVTLLEQCIQGELQ
RAQVMAGERRPAMPEAQWPWLTTLAAALSESDERAHALRLEALEQAQASAGQWTLENDETQTFEWLMDGDARLGPVCETL
VNGRYFWLPFSAIAEIRFQTPASVTDLVWRHALVRLTDGTEQVCQIPARYPFAADASDAVKLARTTEWLPLDDDGTLYEG
LGQKAWLSEQSESPLLSLSLVTFATDGAHE*

  Nucleotide sequence: 813 bp    

>T6CP012788 NC_014121:1567977-1568789 [Enterobacter cloacae subsp. cloacae ATCC 13047] [TagJ]
ATGAATACGCTCTATCAACATCTGGCGGGCGAGTCGCTCAGCGACGCGCTGGTGCGTCTTGAAAACGAGATTAAAGCCCG
TCCGGCGGATGCCGATCTCCGTGCCGCGTTTGTGCAGTTTCTCACCCTCAGCGGTAACTGGACGCGCGCGCTGACCCAGC
TGAAAAGCTGGCTGGCGCTTAAGCCGCAGGCGAAACCCACCGTCACCCTGCTGGAGCAGTGCATTCAGGGAGAACTGCAG
CGCGCGCAGGTGATGGCGGGAGAACGTCGTCCGGCCATGCCGGAAGCCCAGTGGCCATGGCTGACCACCCTTGCTGCCGC
GCTGAGCGAGAGCGATGAACGCGCTCACGCGCTGCGTCTGGAAGCCCTTGAACAGGCGCAGGCGAGCGCGGGGCAATGGA
CGCTAGAGAATGATGAGACGCAGACCTTTGAATGGCTGATGGACGGCGATGCCCGTCTGGGGCCGGTGTGCGAAACCCTT
GTTAACGGCCGTTACTTCTGGCTGCCGTTTAGCGCTATCGCAGAGATCCGTTTCCAGACGCCGGCCAGCGTCACCGATCT
GGTCTGGCGTCATGCGCTGGTGCGTTTGACCGATGGGACGGAGCAGGTGTGTCAGATCCCGGCGCGTTATCCTTTTGCAG
CCGATGCCTCTGACGCCGTTAAACTCGCACGCACCACCGAGTGGCTGCCGCTCGATGATGACGGCACTCTGTATGAAGGG
TTGGGGCAGAAAGCCTGGCTCAGCGAGCAAAGCGAAAGCCCGCTGCTGTCGCTGAGTCTCGTTACTTTTGCAACGGATGG
AGCCCATGAGTAA