Detailed information of component protein


Summary

Component ID T6CP012735
Component protein type TagJ
T6SS ID (Type) T6SS00164 experimental (Type i3)
Strain Acidovorax citrulli AAC00-1
Replicon chromosome
Sequence Protein sequence (263 a.a.); Nucleotide sequence (789 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) AAVE_RS07345
Coordinate (Strand) 1635702..1636490 (+)
NCBI ID WP_017438650.1
RefSeq NC_008752
Uniprot ID UPI00030BC7C5
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ImpE PF07024.15 4.3e-51 138..258

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-262 MQSMNFDFKRPLDRQLAELKDAIRAKPQDAPLRVFYFQVLAVYGEWQKALDQLQICAQLDRKAEAMARAYREVILCEVARRDVFAGKRTPNIVGEPPEWLGWMVEGLQCLAEGRAGQAAELRAAAFEQAPASAGEIDGEAFEWIADSDARLGPVCELYANGSYYWVPFSSVSQIAFEKPQDLRDLVWSACELTLHNGGVMHGFIPTRYPGSETAERDEIRLARATEWRDLGDDQATGWGQRVWATDQGDAALLDVRRVKLSA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9948 - -



  Protein sequence: 263 a.a.    

>T6CP012735 NC_008752:1635702-1636490 [Acidovorax citrulli AAC00-1] [TagJ]
MQSMNFDFKRPLDRQLAELKDAIRAKPQDAPLRVFYFQVLAVYGEWQKALDQLQICAQLDRKAEAMARAYREVILCEVAR
RDVFAGKRTPNIVGEPPEWLGWMVEGLQCLAEGRAGQAAELRAAAFEQAPASAGEIDGEAFEWIADSDARLGPVCELYAN
GSYYWVPFSSVSQIAFEKPQDLRDLVWSACELTLHNGGVMHGFIPTRYPGSETAERDEIRLARATEWRDLGDDQATGWGQ
RVWATDQGDAALLDVRRVKLSA*

  Nucleotide sequence: 789 bp    

>T6CP012735 NC_008752:1635702-1636490 [Acidovorax citrulli AAC00-1] [TagJ]
ATGCAATCCATGAATTTCGATTTCAAGCGCCCGCTGGACCGCCAGCTGGCCGAGCTCAAGGACGCGATCCGGGCCAAGCC
GCAGGATGCGCCGCTGCGGGTGTTCTATTTCCAGGTCCTGGCGGTGTACGGGGAGTGGCAGAAGGCGCTGGACCAGCTGC
AGATCTGTGCCCAGCTGGACCGCAAGGCGGAAGCCATGGCACGTGCCTACCGGGAGGTGATCCTGTGCGAGGTCGCGCGC
CGTGACGTGTTCGCGGGCAAGCGCACGCCCAACATCGTCGGCGAGCCCCCGGAATGGCTCGGATGGATGGTGGAAGGCCT
GCAGTGCCTGGCCGAGGGGCGTGCCGGTCAGGCCGCGGAACTGCGCGCCGCCGCGTTCGAGCAGGCGCCGGCCTCGGCTG
GTGAGATCGACGGCGAGGCGTTCGAGTGGATCGCCGACTCCGACGCGCGCCTGGGCCCGGTCTGCGAGCTGTACGCCAAC
GGCAGCTATTACTGGGTGCCGTTTTCCAGCGTGTCGCAGATCGCCTTCGAGAAGCCGCAGGACCTGCGCGATCTCGTCTG
GTCGGCCTGCGAGCTCACGCTGCACAACGGCGGCGTGATGCATGGGTTCATCCCCACGCGCTATCCGGGCTCCGAAACCG
CCGAGCGCGACGAGATCCGGCTGGCACGCGCCACCGAATGGCGCGACCTGGGGGACGACCAGGCGACGGGCTGGGGCCAG
CGCGTGTGGGCCACGGACCAGGGCGATGCCGCGCTGCTCGACGTGCGGCGGGTGAAGCTGTCCGCCTGA