Detailed information of component protein


Summary

Component ID T6CP012594
Component protein type TagF
T6SS ID (Type) T6SS00764 experimental (Type i3)
Strain Pseudomonas protegens CHA0
Replicon chromosome
Sequence Protein sequence (218 a.a.); Nucleotide sequence (654 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PFLCHA0_RS30115
Coordinate (Strand) 6697331..6697984 (-)
NCBI ID WP_011064248.1
RefSeq NC_021237
Uniprot ID A0A2C9EVR0_PSEPH, Q4K3P5_PSEF5, A0A7U9Q6M2_PSEFL
KEGG ID pfl:PFL_6080, pprc:PFLCHA0_c60390
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TagF_N PF09867.11 3.7e-48 5..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-217 MTAPGLYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQNALGEQWLNAYLISPLWRFALAPGVCGPQAAVGVVMPSIDRVGRYFPLTVAALLEPEADLASLVGGPEQWFEQVEELLLATLEEGASFEALEEGLQALGAPSPASRIEGSHYAGLQRFYVSDPQARGAVLAAQACAGSSAWWGRGSQYISPMLLRCQGLPPASEFAQFLLGQEGAV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9421 - -



  Protein sequence: 218 a.a.    

>T6CP012594 NC_021237:c6697984-6697331 [Pseudomonas protegens CHA0] [TagF]
MTAPGLYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQNALGEQWLNAYLISPLWRFALAPGVCGPQAAVGVVMPSI
DRVGRYFPLTVAALLEPEADLASLVGGPEQWFEQVEELLLATLEEGASFEALEEGLQALGAPSPASRIEGSHYAGLQRFY
VSDPQARGAVLAAQACAGSSAWWGRGSQYISPMLLRCQGLPPASEFAQFLLGQEGAV*

  Nucleotide sequence: 654 bp    

>T6CP012594 NC_021237:c6697984-6697331 [Pseudomonas protegens CHA0] [TagF]
ATGACGGCGCCGGGCCTGTACGGCAAGTTGGCCAGCCGCGGCGATTTTGTCAGCCGTGGCCTGCCGCAGAGTTTCATCGG
CCCCTGGGACAGTTGGCTGGCGGCGGGGCTGCTGGCCAGCCAGAACGCCCTGGGTGAGCAGTGGCTGAACGCCTACCTGA
TCAGCCCGTTGTGGCGCTTCGCCCTGGCCCCCGGGGTCTGCGGGCCCCAGGCGGCGGTCGGGGTGGTGATGCCGAGCATC
GACCGGGTGGGGCGCTATTTCCCCCTGACCGTGGCTGCGCTGCTGGAGCCCGAGGCTGACCTGGCTTCGTTGGTCGGCGG
CCCGGAGCAGTGGTTCGAACAGGTGGAAGAGCTGTTGCTGGCGACCCTGGAAGAGGGCGCCAGTTTCGAAGCCCTGGAAG
AGGGCTTGCAGGCCCTGGGCGCGCCAAGCCCGGCCAGCCGGATCGAAGGCAGCCACTACGCCGGCCTGCAGCGGTTTTAC
GTCAGCGATCCACAGGCCCGGGGCGCGGTACTCGCGGCCCAGGCCTGCGCGGGATCGAGTGCCTGGTGGGGGCGCGGTTC
GCAGTACATCAGCCCAATGCTGTTGCGCTGCCAGGGCTTGCCGCCGGCCAGTGAATTTGCGCAATTTTTGCTCGGACAAG
AGGGTGCCGTCTAA