Detailed information of component protein


Summary

Component ID T6CP012593
Component protein type PppA
T6SS ID (Type) T6SS00764 experimental (Type i3)
Strain Pseudomonas protegens CHA0
Replicon chromosome
Sequence Protein sequence (245 a.a.); Nucleotide sequence (735 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PFLCHA0_RS30110
Coordinate (Strand) 6696596..6697330 (-)
NCBI ID WP_011064247.1
RefSeq NC_021237
Uniprot ID A0A2C9EVQ5_PSEPH, Q4K3P6_PSEF5
KEGG ID pprc:PFLCHA0_c60380, pfl:PFL_6079
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PP2C_2 PF13672.8 2.7e-11 22..212

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-244 MRSAPQLSYQSASYSHVGMVRKINEDAWLEAPETGLWLVADGMGGHAAGDYVSSLIVDSLRAVPAADSLDDYVAALRNGLAAVNAAVREETANRGVTMMGSTVVLLAVRGARAVCLWAGDSRLYRLRDEQLEGISRDHSYVQDLQDSGLLSEAEARVHPRANIVTRAIGVEAQLELSQIDLQVQDGDTFLLCSDGLNKTAEDFELRDVLSHSEPNDVVRSLIHLGLTRGAPDNITAIVIKAAGH



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9830 - -



  Protein sequence: 245 a.a.    

>T6CP012593 NC_021237:c6697330-6696596 [Pseudomonas protegens CHA0] [PppA]
MRSAPQLSYQSASYSHVGMVRKINEDAWLEAPETGLWLVADGMGGHAAGDYVSSLIVDSLRAVPAADSLDDYVAALRNGL
AAVNAAVREETANRGVTMMGSTVVLLAVRGARAVCLWAGDSRLYRLRDEQLEGISRDHSYVQDLQDSGLLSEAEARVHPR
ANIVTRAIGVEAQLELSQIDLQVQDGDTFLLCSDGLNKTAEDFELRDVLSHSEPNDVVRSLIHLGLTRGAPDNITAIVIK
AAGH*

  Nucleotide sequence: 735 bp    

>T6CP012593 NC_021237:c6697330-6696596 [Pseudomonas protegens CHA0] [PppA]
ATGCGTTCAGCGCCGCAACTGTCCTACCAGTCCGCCAGCTACAGCCATGTCGGCATGGTGCGGAAAATCAATGAAGACGC
CTGGCTCGAAGCCCCGGAGACCGGCCTGTGGCTGGTGGCCGACGGTATGGGCGGGCACGCCGCCGGGGACTATGTCAGCA
GCCTGATCGTCGACAGCCTGCGGGCGGTTCCGGCCGCCGACAGCCTGGACGACTATGTCGCCGCGCTGCGCAACGGCCTG
GCCGCGGTCAACGCCGCGGTGCGCGAGGAAACCGCCAACCGTGGGGTGACCATGATGGGCAGCACTGTGGTGCTGCTGGC
GGTACGCGGGGCCCGGGCCGTGTGCCTGTGGGCCGGCGATAGCCGCCTGTACCGGTTGCGGGACGAACAGCTGGAAGGCA
TTTCCCGGGACCACAGCTACGTCCAGGACCTGCAGGACAGCGGCCTGCTCAGCGAGGCCGAGGCGCGGGTGCACCCGCGG
GCCAACATCGTGACCCGGGCGATTGGCGTCGAGGCCCAGCTGGAGCTGTCCCAGATTGACCTGCAGGTGCAGGACGGCGA
CACCTTCCTGCTGTGCAGCGACGGCCTGAACAAGACCGCCGAGGACTTTGAGCTGCGTGACGTGCTCAGCCACAGCGAGC
CCAATGACGTGGTGCGCAGCCTGATCCACCTGGGCCTGACCCGGGGCGCTCCGGACAACATCACCGCCATCGTGATCAAG
GCCGCAGGACACTGA