Detailed information of component protein


Summary

Component ID T6CP012448
Component protein type VirA
T6SS ID (Type) T6SS00113 experimental (Type i1)
Strain Burkholderia thailandensis E264
Replicon chromosome II
Sequence Protein sequence (608 a.a.); Nucleotide sequence (1824 bp)
Reference
[1] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806
[2] Schwarz S, West TE, Boyer F, et al. Burkholderia type VI secretion systems have distinct roles in eukaryotic and bacterial cell interactions. PLoS Pathog. 2010 Aug 26;6(8):e1001068. doi: 10.1371/journal.ppat.1001068. PMID: 20865170
[3] Fisher NA, Ribot WJ, Applefeld W, et al. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis. BMC Microbiol. 2012 Jun 22;12:117. doi: 10.1186/1471-2180-12-117. PMID: 22892068
[4] Schwarz S, Singh P, Robertson JD, et al. VgrG-5 is a Burkholderia type VI secretion system-exported protein required for multinucleated giant cell formation and virulence. Infect Immun. 2014 Apr;82(4):1445-52. doi: 10.1128/IAI.01368-13. Epub 2014 Jan 22. PMID: 24452686
[5] Schwarz S, Singh P, Robertson JD, et al. VgrG-5 is a Burkholderia type VI secretion system-exported protein required for multinucleated giant cell formation and virulence. Infect Immun. 2014 Apr;82(4):1445-52. doi: 10.1128/IAI.01368-13. Epub 2014 Jan 22. PMID: 24452686
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BTH_RS04520
Coordinate (Strand) 1021545..1023368 (+)
NCBI ID WP_009896199.1
RefSeq NC_007650
Uniprot ID UPI00016A9BDA
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
HATPase_c PF02518.28 9e-17 450..584
MASE1 PF05231.16 3e-10 59..319

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-28 MHGNSIDAGPLARARPARIAQAARRDDR
Transmembrane helix 29-48 AFAPGGVLNAAGLLLLLFYA
Outside 49-62 NHLLSRPGACTSLN
Transmembrane helix 63-82 HTLSAVVWPAPVLGIALLLH
Inside 83-88 CRRPLA
Transmembrane helix 89-111 WGLGAASLFVTLLAAGSLDWVPW
Outside 112-114 HVD
Transmembrane helix 115-137 ALFAAVNAVEAIAGAWLARRYVT
Inside 138-149 PGGGVDTLRGFA
Transmembrane helix 150-172 MFVLLLPLGMAAMHATLAAAILS
Outside 173-186 VWMNDRGWLNEWSR
Transmembrane helix 187-209 AYAANALALLALLPALLTWNARA
Inside 210-220 CRAAWLRARNQ
Transmembrane helix 221-243 LPALATFGSLCFASIWGGQAEVA
Outside 244-257 RALLALSLCWAALE
Transmembrane helix 258-280 GGLVLASQLNALAAVGLIAMTLG
Inside 281-292 GRGPYAFHYDGH
Transmembrane helix 293-315 GVWALQVDLIGVAILSMCIAIAT
Outside 316-607 GERRRLAWLVERSRRFESLGFFAGGIVHDFSNVLTTIDCHAEYASERLARGARADESIDEIHRAVERGRDLATQILLAARRGEPVLTRVSVDEVVDDALAAMRAAALRGIEIVRCGDEPCGDGRRGGARHIVFADRSQLSRAVMNLVGNAMRAARATVVVRVGANDGENDDANGGASDGGAPAGGPFDVAIGEPSLPHGVWIEVSDDGDGIEVEPLDRIFEPFYSNRSGAPGTGLGLAIVAGAAIAHRGRIAVATARGAGSRFRLTLPAARGAGAPDETDAGARGPVQERKR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9311 - -



  Protein sequence: 608 a.a.    

>T6CP012448 NC_007650:1021545-1023368 [Burkholderia thailandensis E264] [VirA]
MHGNSIDAGPLARARPARIAQAARRDDRAFAPGGVLNAAGLLLLLFYANHLLSRPGACTSLNHTLSAVVWPAPVLGIALL
LHCRRPLAWGLGAASLFVTLLAAGSLDWVPWHVDALFAAVNAVEAIAGAWLARRYVTPGGGVDTLRGFAMFVLLLPLGMA
AMHATLAAAILSVWMNDRGWLNEWSRAYAANALALLALLPALLTWNARACRAAWLRARNQLPALATFGSLCFASIWGGQA
EVARALLALSLCWAALEGGLVLASQLNALAAVGLIAMTLGGRGPYAFHYDGHGVWALQVDLIGVAILSMCIAIATGERRR
LAWLVERSRRFESLGFFAGGIVHDFSNVLTTIDCHAEYASERLARGARADESIDEIHRAVERGRDLATQILLAARRGEPV
LTRVSVDEVVDDALAAMRAAALRGIEIVRCGDEPCGDGRRGGARHIVFADRSQLSRAVMNLVGNAMRAARATVVVRVGAN
DGENDDANGGASDGGAPAGGPFDVAIGEPSLPHGVWIEVSDDGDGIEVEPLDRIFEPFYSNRSGAPGTGLGLAIVAGAAI
AHRGRIAVATARGAGSRFRLTLPAARGAGAPDETDAGARGPVQERKR*

  Nucleotide sequence: 1824 bp    

>T6CP012448 NC_007650:1021545-1023368 [Burkholderia thailandensis E264] [VirA]
ATGCACGGAAATTCCATCGATGCCGGCCCGCTTGCGCGCGCCCGGCCCGCACGCATCGCGCAGGCCGCGCGCCGCGACGA
TCGCGCATTCGCGCCGGGCGGCGTACTGAACGCGGCGGGGCTGTTGCTGCTGCTGTTCTACGCGAATCATCTGCTGTCGC
GGCCCGGCGCGTGCACGTCGCTCAATCACACGCTGTCGGCCGTCGTGTGGCCCGCGCCGGTGCTCGGCATCGCGTTGCTG
CTGCACTGCCGGCGGCCGCTCGCTTGGGGGCTCGGCGCGGCCTCGCTGTTCGTCACGCTGCTCGCCGCGGGCTCGCTCGA
CTGGGTGCCGTGGCACGTCGACGCGCTGTTCGCGGCCGTCAACGCGGTCGAGGCGATCGCGGGCGCGTGGCTCGCGCGGC
GCTACGTGACGCCGGGCGGCGGCGTGGACACGTTGCGCGGCTTCGCGATGTTCGTGCTGTTGTTGCCGCTCGGCATGGCG
GCGATGCACGCGACGCTCGCGGCGGCGATCCTGTCCGTGTGGATGAACGATCGCGGATGGCTGAACGAATGGTCGCGCGC
GTATGCGGCGAACGCGCTCGCGCTGCTCGCGCTGCTTCCGGCGCTTCTCACGTGGAACGCGCGCGCTTGCCGCGCGGCGT
GGCTGCGCGCCCGCAATCAGCTGCCCGCGCTCGCGACGTTCGGCTCGCTGTGCTTCGCGTCGATATGGGGCGGCCAGGCC
GAGGTCGCGCGCGCGTTGCTCGCGCTGTCGCTGTGCTGGGCCGCGCTCGAGGGCGGCCTCGTGCTCGCGTCGCAGCTCAA
CGCGCTCGCGGCGGTCGGCCTGATCGCGATGACGCTCGGCGGCCGCGGCCCGTATGCGTTTCATTACGACGGGCACGGCG
TTTGGGCGCTGCAGGTCGATCTGATCGGCGTCGCGATCCTGTCGATGTGCATCGCGATCGCGACGGGGGAGAGACGGCGG
CTCGCGTGGCTGGTCGAGCGATCGCGCCGCTTCGAGTCGCTCGGCTTTTTCGCGGGCGGGATCGTTCACGATTTCAGCAA
CGTGCTGACGACGATCGATTGCCACGCCGAATATGCATCCGAGCGCCTCGCGCGCGGCGCGCGCGCGGACGAATCGATCG
ACGAAATCCATCGCGCGGTCGAGCGAGGGCGCGATCTCGCGACGCAGATCCTGCTCGCCGCGCGCCGCGGCGAACCCGTG
CTGACGCGGGTGAGCGTCGACGAGGTCGTCGACGACGCGCTCGCCGCGATGCGCGCAGCCGCGCTGCGGGGCATCGAGAT
CGTTCGGTGCGGCGATGAGCCGTGCGGCGACGGGCGGCGCGGCGGCGCTCGTCACATCGTATTCGCCGATCGCAGCCAGC
TCTCACGCGCGGTGATGAATCTCGTCGGCAACGCGATGCGCGCGGCGCGCGCGACGGTCGTCGTGCGTGTCGGCGCGAAC
GATGGCGAGAACGACGACGCGAACGGCGGCGCGAGCGACGGCGGCGCGCCGGCCGGCGGGCCGTTCGACGTCGCGATCGG
CGAGCCGTCGTTGCCGCACGGCGTGTGGATCGAGGTGAGCGACGACGGCGACGGCATCGAAGTCGAGCCGCTCGACCGCA
TCTTCGAGCCGTTTTATTCGAACCGGTCAGGCGCGCCGGGCACGGGGCTGGGCCTTGCGATCGTCGCGGGCGCGGCGATC
GCGCATCGCGGGCGGATCGCCGTCGCGACGGCGCGCGGCGCGGGCAGCCGCTTCAGGCTCACGTTGCCGGCGGCACGAGG
GGCGGGCGCGCCGGACGAAACGGACGCCGGCGCGCGCGGCCCAGTACAGGAGAGGAAACGATGA