Detailed information of component protein


Summary

Component ID T6CP012427
Component protein type TagF-PppA
T6SS ID (Type) T6SS00016 experimental (Type i5)
Strain Agrobacterium fabrum str. C58
Replicon chromosome linear
Sequence Protein sequence (472 a.a.); Nucleotide sequence (1416 bp)
Reference
[1] Ma LS, Narberhaus F, Lai EM. IcmF family protein TssM exhibits ATPase activity and energizes type VI secretion. J Biol Chem. 2012 May 4;287(19):15610-21. doi: 10.1074/jbc.M111.301630. Epub 2012 Mar 5. PMID: 22393043
[2] Wu HY, Chung PC, Shih HW, et al. Secretome analysis uncovers an Hcp-family protein secreted via a type VI secretion system in Agrobacterium tumefaciens. J Bacteriol. 2008 Apr;190(8):2841-50. doi: 10.1128/JB.01775-07. Epub 2008 Feb 8. PMID: 18263727
[3] Wu CF, Lin JS, Shaw GC, et al. Acid-induced type VI secretion system is regulated by ExoR-ChvG/ChvI signaling cascade in Agrobacterium tumefaciens. PLoS Pathog. 2012 Sep;8(9):e1002938. doi: 10.1371/journal.ppat.1002938. Epub 2012 Sep 27. PMID: 23028331
[4] Lin JS, Ma LS, Lai EM. Systematic dissection of the agrobacterium type VI secretion system reveals machinery and secreted components for subcomplex formation. PLoS One. 2013 Jul 5;8(7):e67647. doi: 10.1371/journal.pone.0067647. Print 2013. PMID: 23861778
[5] Ma LS, Hachani A, Lin JS, et al. Agrobacterium tumefaciens deploys a superfamily of type VI secretion DNase effectors as weapons for interbacterial competition in planta. Cell Host Microbe. 2014 Jul 9;16(1):94-104. doi: 10.1016/j.chom.2014.06.002. Epub 2014 Jun 26. PMID: 24981331
[6] Heckel BC, Tomlinson AD, Morton ER, et al. Agrobacterium tumefaciens exoR controls acid response genes and impacts exopolysaccharide synthesis, horizontal gene transfer, and virulence gene expression. J Bacteriol. 2014 Sep;196(18):3221-33. doi: 10.1128/JB.01751-14. Epub 2014 Jun 30. PMID: 24982308
[7] Lin JS, Wu HH, Hsu PH, et al. Fha interaction with phosphothreonine of TssL activates type VI secretion in Agrobacterium tumefaciens. PLoS Pathog. 2014 Mar 13;10(3):e1003991. doi: 10.1371/journal.ppat.1003991. eCollection 2014 Mar. PMID: 24626341
[8] Heckel BC, Tomlinson AD, Morton ER, et al. Agrobacterium tumefaciens exoR controls acid response genes and impacts exopolysaccharide synthesis, horizontal gene transfer, and virulence gene expression. J Bacteriol. 2014 Sep;196(18):3221-33. doi: 10.1128/JB.01751-14. Epub 2014 Jun 30. PMID: 24982308
[9] Ma LS, Lin JS, Lai EM. An IcmF family protein, ImpLM, is an integral inner membrane protein interacting with ImpKL, and its walker a motif is required for type VI secretion system-mediated Hcp secretion in Agrobacterium tumefaciens. J Bacteriol. 2009 Jul;191(13):4316-29. doi: 10.1128/JB.00029-09. Epub 2009 Apr 24. PMID: 19395482
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ATU_RS20280
Coordinate (Strand) 1459258..1460673 (-)
NCBI ID WP_010973754.1
RefSeq NC_003063
Uniprot ID A0A6V7AAL3_RHIRD, Q7CUN2_AGRFC
KEGG ID atu:Atu4331
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TagF_N PF09867.11 7.4e-42 19..153
PP2C PF00481.23 7.3e-05 275..380

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-471 MADQASRSTQTAAESDRIGFFGKVPSHGDFISDGLERELIATFDDWMRSGMHACADMFAGRWTEIFSSSPPIRFIVESGIWGNCAYAGVLVPSADRVGRKYPLAIIAQLNGFRRHPRTLYLDDTWFMAVEALAETSMTGDFDVSRFNASIKKLRLPKPRDEDDAPEMVRGRAPTSLWWHIDPVSRRARGLKFDGKPRASDFLRLFSDMTGKGDEDGSRAAPAPATVQEKTKQQIPPVTPAPAHPAEQPSSVIYSYATHPGTRLSLNADALFVSQTPSLFAIADGQGDTHSAAEAARLATNILAETPDAENPEMMAQQIRGKLGTVNSLLLSRQATGADGRPMASVVIASIIAHRLSVLWSGDARAYLLKNGTMHQLSRDHVVVGMKKQLSQCVGLSQQFRPDIVFDEWGLQDRLLLCSYPLVQILRERAIAEIVFNTPIKDCANALVQEALIENARENVSAIVIGNRREQG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9792 - -



  Protein sequence: 472 a.a.    

>T6CP012427 NC_003063:c1460673-1459258 [Agrobacterium fabrum str. C58] [TagF-PppA]
MADQASRSTQTAAESDRIGFFGKVPSHGDFISDGLERELIATFDDWMRSGMHACADMFAGRWTEIFSSSPPIRFIVESGI
WGNCAYAGVLVPSADRVGRKYPLAIIAQLNGFRRHPRTLYLDDTWFMAVEALAETSMTGDFDVSRFNASIKKLRLPKPRD
EDDAPEMVRGRAPTSLWWHIDPVSRRARGLKFDGKPRASDFLRLFSDMTGKGDEDGSRAAPAPATVQEKTKQQIPPVTPA
PAHPAEQPSSVIYSYATHPGTRLSLNADALFVSQTPSLFAIADGQGDTHSAAEAARLATNILAETPDAENPEMMAQQIRG
KLGTVNSLLLSRQATGADGRPMASVVIASIIAHRLSVLWSGDARAYLLKNGTMHQLSRDHVVVGMKKQLSQCVGLSQQFR
PDIVFDEWGLQDRLLLCSYPLVQILRERAIAEIVFNTPIKDCANALVQEALIENARENVSAIVIGNRREQG*

  Nucleotide sequence: 1416 bp    

>T6CP012427 NC_003063:c1460673-1459258 [Agrobacterium fabrum str. C58] [TagF-PppA]
ATGGCCGATCAGGCATCAAGGTCCACGCAAACAGCGGCGGAAAGCGATCGCATCGGTTTCTTCGGCAAGGTCCCCAGCCA
TGGCGATTTCATTTCCGATGGGCTCGAGCGGGAATTGATCGCTACCTTCGACGACTGGATGCGATCCGGCATGCACGCCT
GCGCGGATATGTTCGCAGGCCGATGGACAGAGATATTCTCGTCGTCGCCGCCCATACGCTTCATCGTCGAAAGCGGCATA
TGGGGAAACTGCGCCTATGCCGGCGTGCTGGTGCCGAGCGCCGACCGGGTGGGCCGTAAATATCCGCTTGCCATCATTGC
CCAGCTCAACGGCTTCCGCAGACATCCGCGAACACTCTATCTCGACGACACCTGGTTCATGGCCGTAGAGGCATTGGCCG
AGACATCGATGACCGGCGATTTCGACGTGTCCCGGTTTAATGCCTCGATCAAGAAATTGCGCCTACCGAAGCCGCGGGAC
GAGGATGACGCGCCGGAAATGGTCCGCGGCCGCGCGCCGACAAGCCTCTGGTGGCACATCGATCCCGTCAGCCGCCGTGC
ACGCGGCCTCAAATTCGACGGCAAGCCGAGAGCATCCGATTTTCTGCGCCTCTTCAGCGACATGACAGGCAAAGGCGACG
AGGACGGTTCAAGAGCAGCGCCGGCGCCGGCAACGGTGCAGGAGAAGACAAAACAGCAAATACCGCCCGTGACACCCGCG
CCAGCCCACCCAGCGGAACAGCCGTCATCTGTCATCTACAGCTATGCCACACATCCGGGAACGCGGCTTTCCCTGAATGC
GGATGCACTGTTCGTTTCCCAGACGCCTTCCCTCTTCGCCATAGCGGATGGACAAGGCGATACGCATAGCGCCGCAGAGG
CCGCGCGCCTCGCCACGAATATTCTTGCTGAAACGCCAGATGCCGAAAACCCGGAGATGATGGCACAGCAGATCAGGGGA
AAGCTCGGCACCGTCAACAGCCTGCTCCTCTCCCGTCAGGCGACTGGTGCCGATGGCAGGCCGATGGCCAGCGTCGTCAT
AGCCTCGATCATCGCCCACAGGCTGAGCGTCCTGTGGTCCGGTGATGCGCGCGCCTATCTCCTGAAAAACGGCACCATGC
ACCAGCTTTCGCGCGATCACGTCGTTGTCGGCATGAAAAAACAGCTCTCGCAATGTGTCGGGCTTTCCCAGCAATTCCGG
CCGGATATCGTCTTCGATGAGTGGGGTTTGCAGGACAGGCTACTGCTGTGCAGCTACCCGCTCGTACAAATCCTCCGAGA
ACGCGCCATTGCCGAGATCGTCTTCAACACCCCGATCAAGGATTGCGCCAATGCCCTGGTCCAGGAAGCGCTGATCGAAA
ACGCCCGTGAGAATGTCAGCGCCATCGTGATTGGAAACCGGCGTGAGCAAGGCTAG