Detailed information of component protein


Summary

Component ID T6CP012324
Component protein type FHA
T6SS ID (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (423 a.a.); Nucleotide sequence (1269 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BB2000_RS03960
Coordinate (Strand) 932116..933384 (-)
NCBI ID WP_004247648.1
RefSeq NC_022000
Uniprot ID A0A1Z1T1H2_PROMI, A0A6I5JWX6_9GAMM
KEGG ID pvl:AOB99_06110
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-422 MDKYQPTISFSIKNSEQLESGYLPNATLTQSGGQIGSGNQCDWKIQDNEGAIADRQCTVFWKDQHFCLKVNSGPVYINNAIIPLHLDAVRLTQGDQIKVGKLVIATNISLTGEPVQNMMAMTPQSIIAKDHNPLDSLFDVDTTVKNERKEPPFVPTVQGALTTDPLQALENENLSLISKNTQATSDDPLLSDPHSYSSAFPTSDNQENTMVQEFIDLPKITPNENEHMTDVDHVAVNPLMKGLGIHLNLTNTQHANDFLVELGKTVKAAIEGLLILQQQQESLQDKQLRPIEDNPLRLNSGYEETMKLMFTDERSPVHLSAPAAVTESLHNIQLHYQANQEAISTALSTMLAAFSPEHLLNRFSQYRRASDNTPMNDGWAWEMYNNYYKELSSSRQQGFEKLFYEVYSHAYDRALRKGIEEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9570 - -



  Protein sequence: 423 a.a.    

>T6CP012324 NC_022000:c933384-932116 [Proteus mirabilis BB2000] [FHA]
MDKYQPTISFSIKNSEQLESGYLPNATLTQSGGQIGSGNQCDWKIQDNEGAIADRQCTVFWKDQHFCLKVNSGPVYINNA
IIPLHLDAVRLTQGDQIKVGKLVIATNISLTGEPVQNMMAMTPQSIIAKDHNPLDSLFDVDTTVKNERKEPPFVPTVQGA
LTTDPLQALENENLSLISKNTQATSDDPLLSDPHSYSSAFPTSDNQENTMVQEFIDLPKITPNENEHMTDVDHVAVNPLM
KGLGIHLNLTNTQHANDFLVELGKTVKAAIEGLLILQQQQESLQDKQLRPIEDNPLRLNSGYEETMKLMFTDERSPVHLS
APAAVTESLHNIQLHYQANQEAISTALSTMLAAFSPEHLLNRFSQYRRASDNTPMNDGWAWEMYNNYYKELSSSRQQGFE
KLFYEVYSHAYDRALRKGIEEA*

  Nucleotide sequence: 1269 bp    

>T6CP012324 NC_022000:c933384-932116 [Proteus mirabilis BB2000] [FHA]
ATGGATAAATATCAGCCAACAATTTCTTTTAGCATCAAAAATAGTGAACAGCTAGAAAGTGGTTATCTGCCAAATGCGAC
TTTAACTCAAAGTGGCGGACAGATTGGTAGTGGCAATCAATGTGACTGGAAAATCCAAGATAATGAAGGTGCTATTGCCG
ATCGGCAATGTACGGTGTTTTGGAAAGATCAACACTTTTGCTTAAAAGTAAATTCAGGTCCTGTTTACATTAATAATGCG
ATTATTCCATTGCATCTTGATGCCGTTAGACTGACCCAAGGTGATCAGATAAAGGTGGGTAAATTAGTTATTGCCACCAA
TATTAGTCTTACCGGAGAGCCGGTACAAAATATGATGGCGATGACGCCTCAGTCTATTATCGCAAAAGATCATAATCCGC
TAGATTCATTATTTGATGTTGATACAACAGTCAAAAATGAGCGGAAAGAGCCTCCGTTTGTACCAACCGTTCAGGGGGCA
TTAACAACAGACCCACTACAGGCTTTAGAAAACGAAAATCTAAGCTTAATTTCTAAAAACACACAAGCTACTTCAGACGA
TCCTTTATTGAGTGACCCCCACTCGTATTCATCTGCCTTTCCGACATCAGATAATCAAGAGAATACTATGGTCCAAGAAT
TTATTGATTTACCTAAAATCACACCTAATGAAAACGAACATATGACCGATGTCGATCATGTGGCAGTTAACCCTCTGATG
AAGGGATTAGGTATCCACCTTAATTTAACAAATACACAGCATGCTAATGATTTTCTTGTTGAACTGGGTAAAACCGTCAA
AGCGGCTATTGAAGGTTTACTGATTTTGCAACAACAACAAGAAAGCTTACAAGATAAGCAATTACGCCCAATTGAAGATA
ATCCTCTACGTCTTAATAGTGGCTATGAAGAGACAATGAAGTTGATGTTTACCGATGAACGTAGCCCTGTACATCTTTCA
GCACCAGCGGCAGTAACAGAAAGCTTGCACAACATCCAATTGCATTATCAAGCGAATCAAGAAGCTATTTCAACCGCACT
ATCAACCATGTTGGCAGCATTCTCTCCTGAACATTTATTAAACCGCTTTTCTCAGTATCGACGAGCTTCAGATAACACAC
CAATGAATGATGGCTGGGCTTGGGAAATGTACAACAACTATTACAAAGAACTCTCTTCATCTCGGCAACAGGGTTTTGAA
AAATTATTCTATGAAGTATACAGCCATGCTTATGACAGAGCGCTGAGAAAAGGAATAGAGGAAGCTTAA