Detailed information of component protein


Summary

Component ID T6CP012276
Component protein type PAAR
T6SS ID (Type) T6SS00791 experimental (Type i4b)
Strain Edwardsiella tarda PPD130/91
Replicon chromosome
Sequence Protein sequence (101 a.a.); Nucleotide sequence (303 bp)
Reference
[1] Zheng J, Leung KY. Dissection of a type VI secretion system in Edwardsiella tarda. Mol Microbiol. 2007 Dec;66(5):1192-206. Epub 2007 Nov 6. PMID: 17986187
[2] Chakraborty S, Sivaraman J, Leung KY, et al. Two-component PhoB-PhoR regulatory system and ferric uptake regulator sense phosphate and iron to control virulence genes in type III and VI secretion systems of Edwardsiella tarda. J Biol Chem. 2011 Nov 11;286(45):39417-30. doi: 10.1074/jbc.M111.295188. Epub 2011 Sep 27. PMID: 21953460
[3] Jobichen C, Chakraborty S, Li M, et al. Structural basis for the secretion of EvpC: a key type VI secretion system protein from Edwardsiella tarda. PLoS One. 2010 Sep 23;5(9):e12910. doi: 10.1371/journal.pone.0012910. PMID: 20886112
[4] Chakraborty S, Li M, Chatterjee C, et al. Temperature and Mg2+ sensing by a novel PhoP-PhoQ two-component system for regulation of virulence in Edwardsiella tarda. J Biol Chem. 2010 Dec 10;285(50):38876-88. doi: 10.1074/jbc.M110.179150. Epub 2010 Oct 11. PMID: 20937832
[5] Hu W, Anand G, Sivaraman J, et al. A disordered region in the EvpP protein from the type VI secretion system of Edwardsiella tarda is essential for EvpC binding. PLoS One. 2014 Nov 17;9(11):e110810. doi: 10.1371/journal.pone.0110810. eCollection 2014. PMID: 25401506
[6] Rao PS, Yamada Y, Tan YP, et al. Use of proteomics to identify novel virulence determinants that are required for Edwardsiella tarda pathogenesis. Mol Microbiol. 2004 Jul;53(2):573-86. PMID: 15228535
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene) -
Coordinate (Strand) 16475..16777 (+)
NCBI ID 158512117
GenBank AY424360
Uniprot ID A8YQR6_EDWTA
KEGG ID -
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 1.2e-25 24..89
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-100 MGQPAARLTDMHVCPMQTPGVPPVPHVGGPVIGPGVPTVLIGGLPAAVLGDMLTCVGPPDTIIKGSATVLIGGKPAARMGDSTAHGGTITLGCPTVLIGG


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8989 - -


  Protein sequence: 101 a.a.    

>T6CP012276 AY424360:16475-16777 [Edwardsiella tarda] [PAAR]
MGQPAARLTDMHVCPMQTPGVPPVPHVGGPVIGPGVPTVLIGGLPAAVLGDMLTCVGPPDTIIKGSATVLIGGKPAARMG
DSTAHGGTITLGCPTVLIGG*

  Nucleotide sequence: 303 bp    

>T6CP012276 AY424360:16475-16777 [Edwardsiella tarda] [PAAR]
ATGGGACAACCTGCCGCACGTTTGACGGATATGCACGTTTGCCCGATGCAGACCCCGGGCGTTCCCCCGGTGCCGCACGT
CGGCGGCCCGGTCATCGGCCCCGGCGTTCCCACGGTGCTGATCGGCGGACTGCCGGCGGCGGTGCTGGGCGACATGCTGA
CCTGCGTCGGCCCACCCGACACCATTATCAAGGGCAGTGCCACCGTGCTGATCGGCGGCAAGCCCGCCGCCCGCATGGGG
GACAGCACGGCGCATGGTGGCACGATCACGCTGGGCTGCCCCACCGTGTTGATTGGCGGCTAA