SecReT6, T6SS database

Detailed information of component protein

Summary

Component ID	T6CP011756
Component protein type	TagL
T6SS ID (Type)	T6SS00345 (Type Unknown)
Strain	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Replicon	chromosome
Sequence	Protein sequence (566 a.a.); Nucleotide sequence (1698 bp)
Reference	[1] Sarris PF, Zoumadakis C, Panopoulos NJ, et al. Distribution of the putative type VI secretion system core genes in Klebsiella spp. Infect Genet Evol. 2011 Jan;11(1):157-66. doi: 10.1016/j.meegid.2010.09.006. Epub 2010 Oct 4. PMID: 20932940 [2] Hsieh PF, Lu YR, Lin TL, et al. Klebsiella pneumoniae Type VI Secretion System Contributes to Bacterial Competition, Cell Invasion, Type-1 Fimbriae Expression, and In Vivo Colonization. J Infect Dis. 2019 Jan 29;219(4):637-647. doi: 10.1093/infdis/jiy534. PMID: 30202982

Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene)
Coordinate (Strand)	3211181..3212878 (-)
NCBI ID	WP_014907359.1
RefSeq	NC_012731
Uniprot ID	A0A652PZ22_9ENTR, A0A332GY52_KLEPN, A0A3F3AY53_KLEPN
KEGG ID	-
PDB ID	-

Pfam domain hit(s)

Domain	Pfam ID	E-value	Aligned region

Transmembrane helices

Prediction	Region	Sequence
Inside	1-6	MRDNAR
Transmembrane helix	7-29	RLLTILTVILALWLVLGFWPLSI
Outside	30-32	GNQ
Transmembrane helix	33-50	VIFSLCILLAGGAALWRQ
Inside	51-313	RRRAVSRQRSEIVLPPEDFQGAVVLVCGDTDGLFPGRSAHGETRHGWYLRGDSAEQLPGLAQYLAAARPALVSQVSVLLAVVPEHHPSGEHLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAGESRWFTITPERPGLQVQQKGQAPQAVAGWQREGSPASRLHQTLWLESILTLAENALFRPFRARQAELPPLNLCAAGICLTPVAAVANNLWQQQIAAITTLSPGNDAAPGPHPLPDLLLSSLPHRHGVSRRMRD
Transmembrane helix	314-333	AGLSAGVGFLFLALAMLASF
Outside	334-565	INNQRLVRSVGDHLAVYHRLSGTPPTPKLQAQQRLRADSRLLDDWLRRGEPLRYRLGLYQGGRLIPFVEAAINDWAPPPPPRPVIKQVVQGPQTIRLDSMALFDTGKSALKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDRSNQQLSLKRAEAVRDWMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKDACLTPGTANTSGVETNGLKSETE

Signal peptides

Signal peptides and corresponding cleavage sites are predicted using SignalP 5.0 software.

Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).

Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).

Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).

Prediction	Probability	Cleavage site	Signal peptide sequence
Other	0.9967	-	-

Protein sequence: 566 a.a.

Nucleotide sequence: 1698 bp