Detailed information of component protein


Summary

Component ID T6CP011650
Component protein type TagL
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (561 a.a.); Nucleotide sequence (1683 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07400
Coordinate (Strand) 1619849..1621531 (-)
NCBI ID WP_012104863.1
RefSeq NC_010465
Uniprot ID A0A0H3B098_YERPY, A0A0U1QV43_YERP3
KEGG ID ypi:YpsIP31758_1355, ypy:YPK_1467
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
OmpA PF00691.22 2e-17 441..539

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-9 MFKVKLNKT
Transmembrane helix 10-27 LSLLWLAAVGTLLVSVNF
Inside 28-31 KGNA
Transmembrane helix 32-54 LWNNVIFITFLALMVLAIWKHYA
Outside 55-560 LKPKHPQVPIPVPQETAEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSAQVLTFFPFLPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEITQALQSLSQRLELQDINHSGFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRHGAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAIKPRVKTPVIKPIPASRGWLWSVCFAAVLLASHMLNTLWQEKNRHAQFNQQMVPLDNINDFSAQYLARSITQLTDEGKTLTTCVNTFDVTRWGLSQCQTLLSQINRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVEQNKGKKILIVGHSDNTGSSSMNMTLSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9702 - -



  Protein sequence: 561 a.a.    

>T6CP011650 NC_010465:c1621531-1619849 [Yersinia pseudotuberculosis YPIII] [TagL]
MFKVKLNKTLSLLWLAAVGTLLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHPQVPIPVPQETAEPVEQESTV
ILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSAQVLTFFPFLPDVYENAAVMMSKLTVWQN
TFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEITQALQSLSQRLELQDINHSGFATQRNVMAHN
LFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRHGAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAIKPR
VKTPVIKPIPASRGWLWSVCFAAVLLASHMLNTLWQEKNRHAQFNQQMVPLDNINDFSAQYLARSITQLTDEGKTLTTCV
NTFDVTRWGLSQCQTLLSQINRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVEQNKGKKILIVGHS
DNTGSSSMNMTLSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
*

  Nucleotide sequence: 1683 bp    

>T6CP011650 NC_010465:c1621531-1619849 [Yersinia pseudotuberculosis YPIII] [TagL]
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCACCCTATTGGTGAGTGTGAATTT
TAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCTTGCCATCTGGAAACATTACG
CCCTCAAACCCAAACACCCCCAAGTGCCGATTCCCGTCCCGCAGGAGACAGCGGAACCGGTAGAACAGGAAAGTACGGTT
ATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTAACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGC
GGTCTGGATATTAATCACGAATCCCGCCGCGCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCAGG
TATTGACCTTTTTCCCTTTCTTGCCGGATGTCTATGAGAATGCAGCAGTGATGATGTCAAAACTCACGGTGTGGCAGAAC
ACGTTTTCAACGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTATGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAAATTACGCAAGCCCTAC
AGTCACTGAGCCAAAGACTTGAGTTACAAGATATCAATCACTCAGGATTTGCAACTCAGCGTAATGTTATGGCCCATAAT
TTATTTACCTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTATTTTCTCGCGCACCCCCTTACGGCTAACAGA
CGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCATGGTGCCTGGTCAGCCTGGCTGGAGAAAAAGTTTGGCATCA
TACCGAGCTTAGCCTCAACCTTGTCACTGCCACCTTTCCCTGCGGTGATCAATGACCAGAAGCCCGCAATAAAACCACGG
GTGAAAACACCGGTGATAAAACCTATCCCCGCATCCCGTGGGTGGTTATGGAGTGTGTGCTTCGCCGCGGTGCTATTAGC
CTCACATATGCTAAACACCCTGTGGCAAGAAAAAAACCGGCATGCGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAACGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACCGATGAAGGTAAAACATTAACCACATGCGTT
AATACATTTGATGTGACACGTTGGGGGCTGTCTCAATGTCAGACGTTATTAAGCCAAATCAACCGCCGGATTGAATCCTA
TGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACTCAAACAGTACCAAGCTGAAACTGAACTCAC
AAACCAATGAAATGATGATGGAGTTGTTATCACTGGTCGAACAGAATAAAGGGAAAAAAATCTTAATTGTTGGCCATTCT
GATAACACGGGCAGTTCCTCCATGAACATGACACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACG
CAGTGATATCACTGTCGATAATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGG
GTCGAGAACAAAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA