Detailed information of component protein


Summary

Component ID T6CP011649
Component protein type PAAR
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (87 a.a.); Nucleotide sequence (261 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07505
Coordinate (Strand) 1650893..1651153 (+)
NCBI ID WP_002209684.1
RefSeq NC_010465
Uniprot ID A0A0E1NU62_YERPA, A0A0H3B0B0_YERPY, A0A0U1QTT9_YERP3, A0A3G5KMZ3_YERPU, A0A656FF82_YERPE, A0A6B3SVM7_YERPE, Q668S9_YERPS
KEGG ID ypy:YPK_1487, ypk:y1557, ypr:BZ20_3551, yps:YPTB2658, ypw:CH59_3611, ypm:YP_2440, ypc:BZ23_2239, ypl:CH46_2377, ypa:YPA_2119, ypj:CH55_4152, ypq:DJ40_3885, ypo:BZ17_3980, ypv:BZ15_801, ypu:BZ21_1955, ypi:YpsIP31758_1375
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 2.5e-11 8..76

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-86 MFSAAKMGDVTSDGGAICTGSCDVFINNIPASKLGSGATSTLVGLTALVTGSGTVFINNCPATRCSDKTGCGSVIVTGSPNVFIGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7610 - -



  Protein sequence: 87 a.a.    

>T6CP011649 NC_010465:1650893-1651153 [Yersinia pseudotuberculosis YPIII] [PAAR]
MFSAAKMGDVTSDGGAICTGSCDVFINNIPASKLGSGATSTLVGLTALVTGSGTVFINNCPATRCSDKTGCGSVIVTGSP
NVFIGN*

  Nucleotide sequence: 261 bp    

>T6CP011649 NC_010465:1650893-1651153 [Yersinia pseudotuberculosis YPIII] [PAAR]
ATGTTCAGTGCGGCAAAAATGGGCGATGTGACCAGCGATGGTGGTGCGATATGTACCGGTTCATGCGATGTGTTCATTAA
CAATATTCCGGCCTCTAAGCTGGGTTCGGGCGCAACGTCTACGTTGGTAGGCCTGACGGCGCTGGTAACTGGCTCTGGAA
CGGTATTTATCAATAATTGTCCCGCGACGCGTTGTAGTGATAAGACGGGGTGTGGCTCGGTTATTGTCACTGGGTCGCCC
AATGTATTTATAGGTAACTAA