Detailed information of component protein


Summary

Component ID T6CP011402
Component protein type PAAR
T6SS ID (Type) T6SS00013 experimental (Type i1)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (86 a.a.); Nucleotide sequence (258 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS13610
Coordinate (Strand) 2984256..2984513 (-)
NCBI ID WP_003250871.1
RefSeq NC_002947
Uniprot ID A0A0A7PZZ5_PSEPU, A0A2I0CCC7_9PSED, A0A173HE79_9PSED, Q88JN9_PSEPK, A0A1X1A9Z3_PSEPU, A0A2V4EZQ5_9PSED, A0A2N1IT04_9PSED
KEGG ID ppu:PP_2610
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 1.7e-11 2..48
PAAR_motif PF05488.15 8.5e-06 48..76

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-85 MKPIVLVGHRHSCPLHGEGTVETGANATFVDGKAVARVGDRISCGAVIETGAACTIIEGHPAAREGDTTSHGGTLIEGDQGWLID



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9142 - -



  Protein sequence: 86 a.a.    

>T6CP011402 NC_002947:c2984513-2984256 [Pseudomonas putida KT2440] [PAAR]
MKPIVLVGHRHSCPLHGEGTVETGANATFVDGKAVARVGDRISCGAVIETGAACTIIEGHPAAREGDTTSHGGTLIEGDQ
GWLID*

  Nucleotide sequence: 258 bp    

>T6CP011402 NC_002947:c2984513-2984256 [Pseudomonas putida KT2440] [PAAR]
ATGAAACCCATCGTACTGGTAGGCCATCGTCATAGCTGCCCGCTCCATGGCGAAGGCACCGTGGAAACCGGCGCAAATGC
AACATTCGTGGATGGCAAGGCCGTCGCTCGTGTGGGCGATCGCATCAGTTGTGGCGCCGTTATCGAAACCGGCGCTGCCT
GCACGATCATCGAGGGCCACCCCGCAGCAAGGGAGGGTGACACTACCAGTCATGGAGGGACCTTGATCGAGGGGGACCAG
GGTTGGCTCATTGATTGA