Detailed information of component protein


Summary

Component ID T6CP011360
Component protein type PAAR
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (100 a.a.); Nucleotide sequence (300 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24400
Coordinate (Strand) 4901182..4901481 (+)
NCBI ID WP_001390299.1
RefSeq NC_017626
Uniprot ID A0A222QPV7_ECOLX, A0A2H3M3C8_ECOLX, D3GUZ7_ECO44
KEGG ID elo:EC042_4571
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 2.1e-20 25..91

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-99 MPQPAARVTDMHVCPMVTPGLPPVPHVGGPLLPPGSPSVFIGGLPAATLGTLALCSGPVDVVIMGSVKVLICGKPAARMGDICAHGGTIVSGYPQVLIG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8658 - -



  Protein sequence: 100 a.a.    

>T6CP011360 NC_017626:4901182-4901481 [Escherichia coli 042] [PAAR]
MPQPAARVTDMHVCPMVTPGLPPVPHVGGPLLPPGSPSVFIGGLPAATLGTLALCSGPVDVVIMGSVKVLICGKPAARMG
DICAHGGTIVSGYPQVLIG*

  Nucleotide sequence: 300 bp    

>T6CP011360 NC_017626:4901182-4901481 [Escherichia coli 042] [PAAR]
ATGCCTCAACCTGCTGCAAGAGTTACTGATATGCATGTATGTCCTATGGTGACGCCTGGTTTACCACCTGTTCCCCATGT
TGGGGGGCCATTGTTACCACCAGGCTCTCCGTCTGTATTTATTGGTGGATTACCGGCAGCGACATTGGGGACCCTGGCTC
TTTGTTCTGGGCCAGTGGATGTTGTCATTATGGGAAGTGTTAAGGTCTTGATATGCGGCAAACCAGCTGCACGAATGGGC
GATATCTGTGCTCACGGAGGGACAATTGTCAGTGGATATCCTCAGGTATTAATAGGATGA