Detailed information of component protein

Summary

Component ID	T6CP011354
Component protein type	PAAR
T6SS ID (Type)	T6SS00016 (Type i5)
Strain	Agrobacterium fabrum str. C58
Replicon	chromosome linear
Sequence	Protein sequence (102 a.a.); Nucleotide sequence (306 bp)
Reference	[1] Ma LS, Narberhaus F, Lai EM. IcmF family protein TssM exhibits ATPase activity and energizes type VI secretion. J Biol Chem. 2012 May 4;287(19):15610-21. doi: 10.1074/jbc.M111.301630. Epub 2012 Mar 5. PMID: 22393043 [2] Wu HY, Chung PC, Shih HW, et al. Secretome analysis uncovers an Hcp-family protein secreted via a type VI secretion system in Agrobacterium tumefaciens. J Bacteriol. 2008 Apr;190(8):2841-50. doi: 10.1128/JB.01775-07. Epub 2008 Feb 8. PMID: 18263727 [3] Wu CF, Lin JS, Shaw GC, et al. Acid-induced type VI secretion system is regulated by ExoR-ChvG/ChvI signaling cascade in Agrobacterium tumefaciens. PLoS Pathog. 2012 Sep;8(9):e1002938. doi: 10.1371/journal.ppat.1002938. Epub 2012 Sep 27. PMID: 23028331 [4] Lin JS, Ma LS, Lai EM. Systematic dissection of the agrobacterium type VI secretion system reveals machinery and secreted components for subcomplex formation. PLoS One. 2013 Jul 5;8(7):e67647. doi: 10.1371/journal.pone.0067647. Print 2013. PMID: 23861778 [5] Ma LS, Hachani A, Lin JS, et al. Agrobacterium tumefaciens deploys a superfamily of type VI secretion DNase effectors as weapons for interbacterial competition in planta. Cell Host Microbe. 2014 Jul 9;16(1):94-104. doi: 10.1016/j.chom.2014.06.002. Epub 2014 Jun 26. PMID: 24981331 [6] Heckel BC, Tomlinson AD, Morton ER, et al. Agrobacterium tumefaciens exoR controls acid response genes and impacts exopolysaccharide synthesis, horizontal gene transfer, and virulence gene expression. J Bacteriol. 2014 Sep;196(18):3221-33. doi: 10.1128/JB.01751-14. Epub 2014 Jun 30. PMID: 24982308 [7] Lin JS, Wu HH, Hsu PH, et al. Fha interaction with phosphothreonine of TssL activates type VI secretion in Agrobacterium tumefaciens. PLoS Pathog. 2014 Mar 13;10(3):e1003991. doi: 10.1371/journal.ppat.1003991. eCollection 2014 Mar. PMID: 24626341 [8] Heckel BC, Tomlinson AD, Morton ER, et al. Agrobacterium tumefaciens exoR controls acid response genes and impacts exopolysaccharide synthesis, horizontal gene transfer, and virulence gene expression. J Bacteriol. 2014 Sep;196(18):3221-33. doi: 10.1128/JB.01751-14. Epub 2014 Jun 30. PMID: 24982308 [9] Ma LS, Lin JS, Lai EM. An IcmF family protein, ImpLM, is an integral inner membrane protein interacting with ImpKL, and its walker a motif is required for type VI secretion system-mediated Hcp secretion in Agrobacterium tumefaciens. J Bacteriol. 2009 Jul;191(13):4316-29. doi: 10.1128/JB.00029-09. Epub 2009 Apr 24. PMID: 19395482

Experimental investigation has been performed on this T6SS

---

External database links

Locus tag (Gene)	ATU_RS20385
Coordinate (Strand)	1486452..1486757 (+)
NCBI ID	WP_010973769.1
RefSeq	NC_003063
Uniprot ID	A0A7Z7BQV5_9HYPH, A9CGH2_AGRFC, A0A083ZJ11_RHIRD
KEGG ID	atu:Atu4352
PDB ID	-

---

Pfam domain hit(s)

Domain	Pfam ID	E-value	Aligned region
PAAR_motif	PF05488.15	9.7e-18	21..92

---

Transmembrane helices

• Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction	Region	Sequence
Outside	1-101	MVGRSVTLKGHMHICPMVDPGPKPHIGGPVVSTQQTFVTVDGVPIATVGDSLLCTGVPTTSDKITSGSSVATIQGKKIARMGDACAHGGRLVDGVSWLTFE

---

Signal peptides

Prediction	Probability	Cleavage site	Signal peptide sequence
Other	0.9704	-	-

---

  Protein sequence: 102 a.a.    Download


  Nucleotide sequence: 306 bp    Download