Detailed information of component protein
Summary
| Component ID |
T6CP011354 |
| Component protein type |
PAAR |
| T6SS ID (Type) |
T6SS00016 (Type i5) |
| Strain |
Agrobacterium fabrum str. C58 |
| Replicon |
chromosome linear |
| Sequence |
Protein sequence (102 a.a.); Nucleotide sequence (306 bp) |
| Reference |
[1] Ma LS, Narberhaus F, Lai EM. IcmF family protein TssM exhibits ATPase activity and energizes type VI secretion. J Biol Chem. 2012 May 4;287(19):15610-21. doi: 10.1074/jbc.M111.301630. Epub 2012 Mar 5. PMID: 22393043[2] Wu HY, Chung PC, Shih HW, et al. Secretome analysis uncovers an Hcp-family protein secreted via a type VI secretion system in Agrobacterium tumefaciens. J Bacteriol. 2008 Apr;190(8):2841-50. doi: 10.1128/JB.01775-07. Epub 2008 Feb 8. PMID: 18263727[3] Wu CF, Lin JS, Shaw GC, et al. Acid-induced type VI secretion system is regulated by ExoR-ChvG/ChvI signaling cascade in Agrobacterium tumefaciens. PLoS Pathog. 2012 Sep;8(9):e1002938. doi: 10.1371/journal.ppat.1002938. Epub 2012 Sep 27. PMID: 23028331[4] Lin JS, Ma LS, Lai EM. Systematic dissection of the agrobacterium type VI secretion system reveals machinery and secreted components for subcomplex formation. PLoS One. 2013 Jul 5;8(7):e67647. doi: 10.1371/journal.pone.0067647. Print 2013. PMID: 23861778[5] Ma LS, Hachani A, Lin JS, et al. Agrobacterium tumefaciens deploys a superfamily of type VI secretion DNase effectors as weapons for interbacterial competition in planta. Cell Host Microbe. 2014 Jul 9;16(1):94-104. doi: 10.1016/j.chom.2014.06.002. Epub 2014 Jun 26. PMID: 24981331[6] Heckel BC, Tomlinson AD, Morton ER, et al. Agrobacterium tumefaciens exoR controls acid response genes and impacts exopolysaccharide synthesis, horizontal gene transfer, and virulence gene expression. J Bacteriol. 2014 Sep;196(18):3221-33. doi: 10.1128/JB.01751-14. Epub 2014 Jun 30. PMID: 24982308[7] Lin JS, Wu HH, Hsu PH, et al. Fha interaction with phosphothreonine of TssL activates type VI secretion in Agrobacterium tumefaciens. PLoS Pathog. 2014 Mar 13;10(3):e1003991. doi: 10.1371/journal.ppat.1003991. eCollection 2014 Mar. PMID: 24626341[8] Heckel BC, Tomlinson AD, Morton ER, et al. Agrobacterium tumefaciens exoR controls acid response genes and impacts exopolysaccharide synthesis, horizontal gene transfer, and virulence gene expression. J Bacteriol. 2014 Sep;196(18):3221-33. doi: 10.1128/JB.01751-14. Epub 2014 Jun 30. PMID: 24982308[9] Ma LS, Lin JS, Lai EM. An IcmF family protein, ImpLM, is an integral inner membrane protein interacting with ImpKL, and its walker a motif is required for type VI secretion system-mediated Hcp secretion in Agrobacterium tumefaciens. J Bacteriol. 2009 Jul;191(13):4316-29. doi: 10.1128/JB.00029-09. Epub 2009 Apr 24. PMID: 19395482 |

Experimental investigation has been performed on this T6SS
External database links
Pfam domain hit(s)
| Domain |
Pfam ID |
E-value |
Aligned region |
| PAAR_motif |
PF05488.15 |
9.7e-18
|
21..92 |
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction |
Region |
Sequence |
| Outside |
1-101 |
MVGRSVTLKGHMHICPMVDPGPKPHIGGPVVSTQQTFVTVDGVPIATVGDSLLCTGVPTTSDKITSGSSVATIQGKKIARMGDACAHGGRLVDGVSWLTFE |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction |
Probability |
Cleavage site |
Signal peptide sequence |
| Other |
0.9704 |
- |
- |
Protein sequence: 102 a.a.
>T6CP011354 NC_003063:1486452-1486757 [Agrobacterium fabrum str. C58] [PAAR]
MVGRSVTLKGHMHICPMVDPGPKPHIGGPVVSTQQTFVTVDGVPIATVGDSLLCTGVPTTSDKITSGSSVATIQGKKIAR
MGDACAHGGRLVDGVSWLTFE*
Nucleotide sequence: 306 bp
>T6CP011354 NC_003063:1486452-1486757 [Agrobacterium fabrum str. C58] [PAAR]
ATGGTCGGGCGCTCGGTCACGCTGAAAGGTCATATGCACATCTGCCCCATGGTCGATCCCGGGCCGAAGCCACACATCGG
TGGACCTGTGGTCTCGACGCAACAGACTTTTGTCACCGTTGACGGTGTGCCGATCGCTACGGTTGGAGACAGCCTGCTTT
GCACAGGCGTTCCGACAACGTCGGACAAGATTACCAGTGGCTCATCGGTCGCTACCATACAGGGGAAAAAAATTGCCCGC
ATGGGGGATGCCTGCGCGCATGGTGGGAGGCTGGTCGACGGCGTTTCCTGGCTAACGTTCGAGTGA