Detailed information of component protein


Summary

Component ID T6CP011347
Component protein type PAAR
T6SS ID (Type) T6SS00788 experimental (Type i1)
Strain Aeromonas dhakensis strain SSU
Replicon chromosome
Sequence Protein sequence (96 a.a.); Nucleotide sequence (288 bp)
Reference
[1] Suarez G, Sierra JC, Sha J, et al. Molecular characterization of a functional type VI secretion system from a clinical isolate of Aeromonas hydrophila. Microb Pathog. 2008 Apr;44(4):344-61. Epub 2007 Oct 24. PMID: 18037263
[2] Suarez G, Sierra JC, Erova TE, et al. A type VI secretion system effector protein, VgrG1, from Aeromonas hydrophila that induces host cell toxicity by ADP ribosylation of actin. J Bacteriol. 2010 Jan;192(1):155-68. doi: 10.1128/JB.01260-09. PMID: 19880608
[3] Sha J, Rosenzweig JA, Kozlova EV, et al. Evaluation of the roles played by Hcp and VgrG type 6 secretion system effectors in Aeromonas hydrophila SSU pathogenesis. Microbiology (Reading). 2013 Jun;159(Pt 6):1120-1135. doi: 10.1099/mic.0.063495-0. Epub 2013 Mar 21. PMID: 23519162
[4] Suarez G, Sierra JC, Kirtley ML, et al. Role of Hcp, a type 6 secretion system effector, of Aeromonas hydrophila in modulating activation of host immune cells. Microbiology (Reading). 2010 Dec;156(Pt 12):3678-3688. doi: 10.1099/mic.0.041277-0. Epub 2010 Aug 26. PMID: 20798163
[5] Grim CJ, Kozlova EV, Ponnusamy D, et al. Functional genomic characterization of virulence factors from necrotizing fasciitis-causing strains of Aeromonas hydrophila. Appl Environ Microbiol. 2014 Jul;80(14):4162-83. doi: 10.1128/AEM.00486-14. Epub 2014 May 2. PMID: 24795370
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) HMPREF1171_RS04785
Coordinate (Strand) 1050225..1050512 (+)
NCBI ID WP_005300007.1
RefSeq NZ_JH815591
Uniprot ID A0A2I8R3L7_9GAMM, K1KBF6_9GAMM, A0A7I6PXX1_9GAMM, Q0PZF8_AERHY
KEGG ID adh:CK627_16770, aea:C2U39_08885
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 8.6e-14 19..87

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-95 MCPSIALLGDIGTDHEGFHPSPVIAASPDVFLDGKPVARQGDPLAPHDKPNNPPHPRSISGGVGSVLVNGKPIAVTGTAVGCGGVVIGSGSGQAG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9495 - -



  Protein sequence: 96 a.a.    

>T6CP011347 NZ_JH815591:1050225-1050512 [Aeromonas dhakensis] [PAAR]
MCPSIALLGDIGTDHEGFHPSPVIAASPDVFLDGKPVARQGDPLAPHDKPNNPPHPRSISGGVGSVLVNGKPIAVTGTAV
GCGGVVIGSGSGQAG*

  Nucleotide sequence: 288 bp    

>T6CP011347 NZ_JH815591:1050225-1050512 [Aeromonas dhakensis] [PAAR]
ATGTGTCCTTCTATTGCATTGCTCGGTGACATCGGTACCGACCACGAGGGTTTCCACCCATCCCCCGTGATTGCCGCCAG
CCCGGATGTGTTCCTCGATGGCAAGCCGGTGGCCCGCCAGGGTGATCCGCTGGCCCCCCACGACAAACCCAACAATCCAC
CCCATCCGCGCAGCATCTCGGGCGGCGTCGGCTCTGTGCTGGTCAACGGCAAGCCCATCGCCGTGACCGGCACCGCAGTC
GGCTGCGGCGGCGTGGTGATTGGCTCGGGCAGCGGACAGGCAGGTTAA