Detailed information of component protein
Summary
| Component ID | T6CP011096 |
| Component protein type | TssO |
| T6SS ID (Type) | T6SS00910  (Type iii) |
| Strain | Flavobacterium johnsoniae UW101 |
| Replicon | chromosome |
| Sequence | Protein sequence (171 a.a.); Nucleotide sequence (513 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 3906545..3907057 (-) |
| NCBI ID | WP_012025253.1 |
| RefSeq | NC_009441 |
| Uniprot ID | A5FES9_FLAJ1, A0A1M5MUP4_FLAJO |
| KEGG ID | fjo:Fjoh_3268 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Inside | 1-12 | MEVLNKQERQKA |
| Transmembrane helix | 13-35 | FIAFLIAFTLTFCVMLIAVSFNF |
| Outside | 36-170 | YMPVAENKMLKAENEMMKREYDYQTNFSVKIDSIRMTIDSINSPKVDNDFQQRLANVMIANIYQKVPKDTTENKKLYNNVILAYKNIIDYKKQIRSLTHNSHLIDSLNQSAKTYKEELEKVSRDLDVCRQIYQNQ |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.9747 | - | - |
Protein sequence: 171 a.a.
Nucleotide sequence: 513 bp