Detailed information of component protein


Summary

Component ID T6CP011092
Component protein type TssD
T6SS ID (Type) T6SS00910 experimental (Type iii)
Strain Flavobacterium johnsoniae UW101
Replicon chromosome
Sequence Protein sequence (129 a.a.); Nucleotide sequence (387 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) FJOH_RS16915
Coordinate (Strand) 3902237..3902623 (-)
NCBI ID WP_012025247.1
RefSeq NC_009441
Uniprot ID A0A7K1FY81_9FLAO, A5FET8_FLAJ1, A0A1M6UNC2_FLAJO
KEGG ID fjo:Fjoh_3262
PDB ID 6BDC

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
TssD PF17642.3 2.2e-48 1..128

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-128 MSFLTSLTVAGKDYKVLNVSYDLAQETDASGRPSTVTRGGRIMIEVESTGSTELFEWMTNNFERKDGSVKFIKRDSNATLKELKFTEAYMVKYKENFDHNSENPLTETFMISARKISMGGGEFDNAWV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9165 - -



  Protein sequence: 129 a.a.    

>T6CP011092 NC_009441:c3902623-3902237 [Flavobacterium johnsoniae UW101] [TssD]
MSFLTSLTVAGKDYKVLNVSYDLAQETDASGRPSTVTRGGRIMIEVESTGSTELFEWMTNNFERKDGSVKFIKRDSNATL
KELKFTEAYMVKYKENFDHNSENPLTETFMISARKISMGGGEFDNAWV*

  Nucleotide sequence: 387 bp    

>T6CP011092 NC_009441:c3902623-3902237 [Flavobacterium johnsoniae UW101] [TssD]
ATGTCGTTTTTAACATCATTAACAGTAGCAGGAAAAGATTACAAAGTATTAAACGTAAGTTATGATTTAGCTCAAGAAAC
AGATGCTTCTGGGCGTCCATCTACGGTAACACGCGGAGGAAGAATCATGATCGAAGTTGAATCAACTGGAAGTACTGAAT
TATTTGAATGGATGACTAACAATTTCGAAAGAAAAGACGGGTCAGTAAAATTCATCAAACGTGATTCAAATGCTACTTTA
AAAGAGCTAAAGTTTACAGAGGCTTACATGGTTAAGTACAAAGAAAACTTTGATCATAACAGTGAAAATCCATTAACTGA
AACTTTTATGATTTCTGCTCGTAAAATTTCGATGGGTGGAGGAGAATTTGATAATGCTTGGGTATAA