Detailed information of component protein


Summary

Component ID T6CP011005
Component protein type TssL
T6SS ID (Type) T6SS00790 experimental (Type i1)
Strain Vibrio cholerae V52
Replicon chromosome
Sequence Protein sequence (258 a.a.); Nucleotide sequence (774 bp)
Reference
[1] Pukatzki S, Ma AT, Sturtevant D, et al. Identification of a conserved bacterial protein secretion system in Vibrio cholerae using the Dictyostelium host model system. Proc Natl Acad Sci U S A. 2006 Jan 31;103(5):1528-33. Epub 2006 Jan 23. PMID: 16432199
[2] Ma AT, Mekalanos JJ. In vivo actin cross-linking induced by Vibrio cholerae type VI secretion system is associated with intestinal inflammation. Proc Natl Acad Sci U S A. 2010 Mar 2;107(9):4365-70. doi: 10.1073/pnas.0915156107. Epub 2010 Feb 11. PMID: 20150509
[3] Dong TG, Ho BT, Yoder-Himes DR, et al. Identification of T6SS-dependent effector and immunity proteins by Tn-seq in Vibrio cholerae. Proc Natl Acad Sci U S A. 2013 Feb 12;110(7):2623-8. doi: 10.1073/pnas.1222783110. Epub 2013 Jan 29. PMID: 23362380
[4] Ma AT, McAuley S, Pukatzki S, et al. Translocation of a Vibrio cholerae type VI secretion effector requires bacterial endocytosis by host cells. Cell Host Microbe. 2009 Mar 19;5(3):234-43. doi: 10.1016/j.chom.2009.02.005. PMID: 19286133
[5] Miyata ST, Kitaoka M, Brooks TM, et al. Vibrio cholerae requires the type VI secretion system virulence factor VasX to kill Dictyostelium discoideum. Infect Immun. 2011 Jul;79(7):2941-9. doi: 10.1128/IAI.01266-10. Epub 2011 May 9. PMID: 21555399
[6] Shao Y, Bassler BL. Quorum regulatory small RNAs repress type VI secretion in Vibrio cholerae. Mol Microbiol. 2014 Jun;92(5):921-30. doi: 10.1111/mmi.12599. Epub 2014 Apr 24. PMID: 24698180
[7] Unterweger D, Miyata ST, Bachmann V, et al. The Vibrio cholerae type VI secretion system employs diverse effector modules for intraspecific competition. Nat Commun. 2014 Apr 1;5:3549. doi: 10.1038/ncomms4549. PMID: 24686479
[8] Borgeaud S, Metzger LC, Scrignari T, et al. The type VI secretion system of Vibrio cholerae fosters horizontal gene transfer. Science. 2015 Jan 2;347(6217):63-7. doi: 10.1126/science.1260064. PMID: 25554784
[9] Stietz MS, Liang X, Li H, et al. TssA-TssM-TagA interaction modulates type VI secretion system sheath-tube assembly in Vibrio cholerae. Nat Commun. 2020 Oct 8;11(1):5065. doi: 10.1038/s41467-020-18807-9. PMID: 33033237
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene)
Coordinate (Strand) 216489..217262 (-)
NCBI ID WP_000083407.1
RefSeq NZ_KQ410497
Uniprot ID A0A366ABD3_9VIBR, A0A366ATH9_9VIBR, D7HAU5_VIBCL, A0A023PTG4_VIBCL
KEGG ID vcx:VAA049_1793, vcz:VAB027_914
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-219 MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTIEEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILSRLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRAKYTLSRQMP
Transmembrane helix 220-242 VWSVFAGFIVLWIGLFLGYSYVL
Outside 243-257 HSKSSDVLNQLNQIL


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9933 - -


  Protein sequence: 258 a.a.    


  Nucleotide sequence: 774 bp