Detailed information of component protein


Summary

Component ID T6CP010995
Component protein type TssM
T6SS ID (Type) T6SS00792 experimental (Type i4b)
Strain Acinetobacter baumannii M2
Replicon chromosome
Sequence Protein sequence (1253 a.a.); Nucleotide sequence (3759 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) -
Coordinate (Strand) 10082..13840 (+)
NCBI ID 507480531
GenBank KC432605
Uniprot ID R9RIP9_ACIBA
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related PF06761.14 2.6e-83 469..810
IcmF-related_N PF14331.8 1.4e-77 161..417
IcmF_C PF06744.14 3.7e-18 1080..1170

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-9 MSSYTSIPR
Transmembrane helix 10-32 HIFWALASAYALGLIVYGIYWLI
Inside 33-415 QRKKHAVQGEELAEAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPVNGLILIVSIAELVSQSPEHSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEVQEYNQAWGATLPYEQNSSHNAVDLFEKHYTILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKTFIATLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQNEVRDQLKTTPNHGYFLKGLFSEVILKDKDLVKQHVNTSRKRQR
Transmembrane helix 416-435 YIAFIGALAGVSIILGVWVW
Outside 436-1252 SYRNNQQLISEVQADLNKVVQLEKGSSQQLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLTPTQQNIAQYLQRVKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRAAVRFPALTVSQIVGEANKNVVLGSYALPGVFTQKAWNDYVEKAIEEAADKPTDSKDWVLNSRQSDDLTFSGSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKANQFAQQVKNIDVLGEPQNSPIRTLIERVAIETNWDNPVVQAELAAPQKGFIAWFKRKVLNRDDKQLANQAVANAQGAISQEYQMFYQLVRKRDDQQGKSLLDEYMTNLALVRSKFNELKNAGEVGPSAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQAFESLITPTQDEINKLWVMQAYQPFTTNLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFVIRRGYTLTSKTWKDLGISLNPQFVMNFQRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSYTVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPVKPANPVAALTQPAATQPAAGVKP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9942 - -



  Protein sequence: 1253 a.a.    

>T6CP010995 KC432605:10082-13840 [Acinetobacter baumannii] [TssM]
MSSYTSIPRHIFWALASAYALGLIVYGIYWLIQRKKHAVQGEELAEAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIR
KSKLGDKKGNAALYELPWYMVIGNPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVY
SEDHSEWLGFLNILKKNRSKAPVNGLILIVSIAELVSQSPEHSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGF
TEFFEFYEVQEYNQAWGATLPYEQNSSHNAVDLFEKHYTILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALK
TFIATLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQNEVRDQLKTTPNHGYFLKGLFSEVILKDK
DLVKQHVNTSRKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLISEVQADLNKVVQLEKGSSQQLSTQLEALLILQRRLQ
QLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLTPTQQNIAQYLQRVKNNEATLKANHTNVEIKQTAQTQQYL
EPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDA
DSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRAAVRFPALTVSQIVGEANKNVVLGSYALPGVFTQKAWNDYVEKAIEEA
ADKPTDSKDWVLNSRQSDDLTFSGSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKANQFAQQVKNIDVLGEPQNSPIRT
LIERVAIETNWDNPVVQAELAAPQKGFIAWFKRKVLNRDDKQLANQAVANAQGAISQEYQMFYQLVRKRDDQQGKSLLDE
YMTNLALVRSKFNELKNAGEVGPSAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQAFESLIT
PTQDEINKLWVMQAYQPFTTNLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFVIRRGYTLTSKTWKDLGI
SLNPQFVMNFQRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSYTVDIDGQRMTYENGVQQWVNFIWPNQG
SIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYSG
MQLVDKVTADKAARVVSAQQAPAQAAAPVKPANPVAALTQPAATQPAAGVKP*

  Nucleotide sequence: 3759 bp    

>T6CP010995 KC432605:10082-13840 [Acinetobacter baumannii] [TssM]
ATGTCTTCCTATACTTCAATTCCTCGCCATATATTTTGGGCTTTAGCATCTGCATATGCTTTAGGGCTCATTGTTTATGG
AATTTATTGGCTAATTCAGCGCAAGAAGCATGCGGTTCAAGGTGAAGAGCTTGCTGAAGCAATTGAAAAAGATACTCAAG
CAGAGTACGGAAAAAATAAAGATAAAGAAGAACTACAACTTATCAGCCAGCAAATGAAAGAATCTATTCAATTGATTCGT
AAGTCAAAGTTAGGCGATAAGAAGGGTAATGCAGCACTATATGAATTGCCGTGGTATATGGTTATTGGTAACCCAGCCGC
TGGTAAAAGTTCTGCGATCTATAATTCTGGTTTAAAGTTCCCTTTTGAAGAAACCCATCAAAAAATGGTTTCGGCTGGTT
TAAGTGGTACCCGTAATTGTGACTGGTTCTTTTCTACAGAGGGTATTTTATTAGATACGGCTGGTCGTTATTCGGTATAT
AGTGAAGATCATTCAGAGTGGTTAGGTTTTTTAAATATATTAAAGAAGAACCGTTCTAAAGCTCCGGTAAATGGCTTAAT
TCTTATTGTAAGTATTGCTGAGCTGGTGAGCCAAAGCCCTGAACACTCATTGAAACTTGCTAAAAATTTACGTGCTCGTA
TTCAAGATTTAACTGAGCGTTTAGAAGTTGTAGTGCCTGTTTATTTAGTCTTTTCAAAAATGGATTTGATTGCGGGTTTT
ACCGAATTTTTCGAATTCTATGAAGTCCAAGAATATAATCAGGCATGGGGTGCCACACTACCATATGAGCAAAACTCTTC
TCATAATGCGGTAGATCTTTTTGAGAAACATTACACTATTCTTTACGATGGTTTAAAAGGGGTGAGCTCGACTCATCTTA
GCCGTCGACACTCTCAAAATATCTCACCGAGTGTGATGACTTTCCCATTAGAATTTAAAACATTAAAGCCTGCGTTAAAA
ACCTTTATTGCAACACTGTTTGAAGATAACCCTTACCAGTTCCAGCCAGTTTTCCGTGGTTTCTATTTCACAAGTGCCTT
GCAAGAAGGTGTGATCGAAAGTCCAATGACTGAGCAAATTGCACAAGAATTTCAGCTTTCTCAAATTGCTCAAAATGAAG
TAAGAGATCAATTAAAAACAACACCTAACCATGGTTATTTCTTAAAAGGCTTATTTTCCGAAGTCATTTTAAAAGATAAA
GATTTAGTTAAACAGCATGTTAATACAAGCAGAAAACGTCAACGCTACATTGCATTTATCGGTGCTTTAGCGGGTGTTTC
AATTATTCTGGGTGTATGGGTTTGGTCGTATCGCAATAACCAACAGCTTATTTCTGAAGTTCAAGCTGATTTAAATAAAG
TCGTTCAGTTAGAGAAGGGTTCAAGTCAGCAGTTGTCGACTCAATTGGAAGCCCTACTTATTTTACAAAGACGTCTACAA
CAATTAGACGAGTTTGATGAAAACAGACCTCTAAAATTTAGCTTTGGTTTATATCAAGGCAATGAGTTACGTGAAAAATT
AAAAGCTGAATATTTAAAAGGCGTTAAACAAATTGTTTTAACACCTACTCAGCAAAATATTGCTCAATATTTGCAACGTG
TAAAAAATAACGAAGCGACTTTAAAAGCTAATCATACCAATGTAGAGATTAAGCAAACTGCTCAAACTCAGCAATATCTA
GAGCCTTCAGATACCAATCCTCAAGATGCTTATAATGCATTAAAAGCATATTTGATGATGAGTAATCCACAGTATATGGA
TGCAAGTCATTTAAGTGATCAAGTAACGCGTTTCTGGCGTTCTTGGCTTGATGCCAATAAAGGGCAGATGCCACGTGCAG
ATATGATTCAGGAAGCTGAACAGATCTTATCGTATGCAATGACATTAGCAAATGACAAGCAATTCCCGATTTTGGATGCT
GACTCTCAATTAGTTGATCAGACACGTCAAGTATTGCTCTCTGTGATTAGAGGTATGCCAGCACGTGACCGTGTTTATAA
CGAAATTAAAATGCGTGCTGCTGTTCGCTTCCCAGCTTTGACAGTAAGTCAAATTGTTGGTGAGGCAAATAAAAATGTTG
TGTTAGGCAGCTATGCATTACCAGGTGTATTTACTCAAAAAGCTTGGAATGACTACGTAGAAAAAGCCATTGAGGAAGCA
GCAGATAAGCCTACAGATAGTAAAGACTGGGTGCTTAATAGTCGTCAATCTGATGACTTAACTTTCTCGGGTAGCCCAGA
GCAAATTAGAAAGCAGCTCACAGCACTTTATAAGCAAGAATATATTGCGGAATGGAGAAAATTCTTAAGTGGTATTCACT
ATGCAAAAGCAAATCAATTTGCTCAGCAAGTCAAAAATATTGATGTATTAGGTGAGCCACAAAATTCACCAATTCGCACG
CTTATTGAACGTGTAGCAATTGAAACAAATTGGGATAATCCAGTTGTTCAAGCAGAATTAGCTGCTCCTCAAAAAGGATT
TATTGCATGGTTCAAACGCAAAGTCTTAAACCGTGATGATAAACAATTAGCAAATCAAGCAGTTGCTAATGCTCAAGGTG
CTATTTCTCAAGAATATCAAATGTTTTATCAGTTGGTTCGTAAACGTGATGATCAACAGGGTAAATCTTTACTTGATGAA
TATATGACAAATCTTGCTTTAGTGCGTAGTAAGTTTAATGAACTTAAAAATGCGGGTGAGGTTGGGCCAAGTGCTATGAC
ATTAGTTAAGCAAACCTTAAATGAGCAGACATCGGTATTTAATCAGACTCAAAAAATTGTAGATGAAAAAATGGCGGTTG
GTTTCAGTGAAATTGATCAGCAATTGCTACAAAAATTAGTGGTAAGTCCTCTTACACAAGCTTTTGAAAGTCTAATTACA
CCGACTCAAGATGAAATTAATAAACTTTGGGTTATGCAAGCGTATCAGCCATTTACAACAAATCTTGCTAAGAAATATCC
GTTTAACTCATCCGCTTCTTTACAAGCAACAAGTAGTGAAATTGGTCAAATTCTTGGTGAAAACGGTAGCATTTCCCGTT
TTGTTAAAGAGAGCTTAGACCCATTTGTTATTCGTCGTGGCTATACCTTAACTTCAAAAACATGGAAAGATTTGGGTATT
AGTTTAAACCCGCAATTTGTAATGAATTTCCAACGCTATGTTGCACCTACAAATGGTATGGCAACTGGGGAGTTAAATAG
TCAAGCACCAGCGGCTCCGGCAACAAATCAGTCTAACTTCCAGTTCTACCCAATTCAAAACCCGCAATTGCTTTCATATA
CCGTTGATATTGATGGTCAGCGTATGACTTATGAAAATGGTGTACAGCAATGGGTTAACTTTATTTGGCCAAATCAAGGC
AGTATTCCTGGTGCACGTATTACGGCTGTAGATTTACAAGGTCAAACGCATACGATTTTTGATGAACCAGGTGAATATGG
CATTAACCGCTTAATTGATAGTGCACAGCGTAAAGAGCAGAACGGTGGTTTCGAAATGCTTTGGCGCAGTAAGACGGATC
CATCATTGTTTGTGAAAATGAACTTCCGTCTTATTAGTAGTAACTCAGGCAGTATTGGTTCAAGTCGCGGTTACTCTGGT
ATGCAATTGGTTGACAAAGTTACTGCTGATAAAGCTGCCCGTGTTGTATCGGCGCAGCAAGCACCAGCTCAGGCAGCTGC
TCCTGTGAAACCTGCAAATCCAGTTGCTGCATTAACACAACCTGCTGCAACTCAACCAGCTGCAGGAGTTAAGCCATGA