Detailed information of component protein


Summary

Component ID T6CP010991
Component protein type TssD
T6SS ID (Type) T6SS00792 experimental (Type i4b)
Strain Acinetobacter baumannii M2
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) -
Coordinate (Strand) 4712..5215 (+)
NCBI ID 507480526
GenBank KC432605
Uniprot ID R9RIP4_ACIBA
KEGG ID abw:BL01_13265
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5.4e-40 5..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-167 MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSNNTASYAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9825 - -



  Protein sequence: 168 a.a.    

>T6CP010991 KC432605:4712-5215 [Acinetobacter baumannii] [TssD]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATSPKLWEACSAG
YTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSN
NTASYAA*

  Nucleotide sequence: 504 bp    

>T6CP010991 KC432605:4712-5215 [Acinetobacter baumannii] [TssD]
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACAAAGGTTGGTT
AGAAGTTAACTCTTGGTCTCATAACATTCGTCAACCTAAATCTGCTACTTCAAGTAGCGTAGGTGGTCACACTGCTGAGC
GTGTTGAACATTCTGACATGGTTTTCGTAAAAGACTTAGATGCTACTAGCCCTAAACTATGGGAAGCATGTTCAGCTGGT
TATACATTTGATGAAGTACAAATCGACTTTTATCGTGCAAATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAA
GCACGTTCTAGTTTCTAGCGTGACTCCAACTGTTAACGAAGAAGGCGTTCCTACAGAAGCATTTGGCTTGAAATATGCTG
CTGTTGAGTGGACTTATAACCAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAAT
AATACAGCTTCTTACGCAGCTTAA